PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WRKY

Protein Properties

Length: 114aa MW: 13469.4 Da PI: 9.992

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
322266	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	103.8	9.2e-33	32	90	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt++ C+vkk+v+r ++++++ve+tYeg Hnh+ 322266 32 LDDGYRWRKYGQKSVKNSLYPRSYYRCTQHMCNVKKQVQRLSKETNMVETTYEGIHNHP 90 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	5.6E-33	17	90	IPR003657	WRKY domain
SuperFamily	SSF118290	1.57E-28	24	91	IPR003657	WRKY domain
PROSITE profile	PS50811	28.128	27	92	IPR003657	WRKY domain
SMART	SM00774	1.7E-37	32	91	IPR003657	WRKY domain
Pfam	PF03106	3.6E-26	33	90	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 114 aa Download sequence Send to blast
MNGLLDSSRD ISHKKMKNPR FAFRTKSDSD LLDDGYRWRK YGQKSVKNSL YPRSYYRCTQ 60 HMCNVKKQVQ RLSKETNMVE TTYEGIHNHP CEEHMQTLTP LLHQMQFLSK LIT*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	3e-25	22	89	7	74	Probable WRKY transcription factor 4
2lex_A	3e-25	22	89	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00317	DAP	Transfer from AT2G46130	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	322266

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117931	1e-135	AK117931.1 Arabidopsis thaliana At2g46130 mRNA for putative WRKY transcription factor (WRKY43), complete cds, clone: RAFL19-12-A14.
GenBank	BT004701	1e-135	BT004701.1 Arabidopsis thaliana At2g46130 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002880217.1	1e-81	probable WRKY transcription factor 43 isoform X1
Swissprot	Q8GY11	2e-71	WRK43_ARATH; Probable WRKY transcription factor 43
TrEMBL	D7LDW5	2e-80	D7LDW5_ARALL; WRKY DNA-binding protein 43
STRING	fgenesh1_pm.C_scaffold_4002323	4e-81	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM509	28	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46130.1	9e-74	WRKY DNA-binding protein 43

Link Out ? help Back to Top
Phytozome	322266
Entrez Gene	9318118

Publications ? help Back to Top
Geilen K,Heilmann M,Hillmer S,Böhmer M WRKY43 regulates polyunsaturated fatty acid content and seed germination under unfavourable growth conditions. Sci Rep, 2017. 7(1): p. 14235 [PMID:29079824]