PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 322266 | ||||||||
Common Name | ARALYDRAFT_322266, WRKY43 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 114aa MW: 13469.4 Da PI: 9.992 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.8 | 9.2e-33 | 32 | 90 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt++ C+vkk+v+r ++++++ve+tYeg Hnh+ 322266 32 LDDGYRWRKYGQKSVKNSLYPRSYYRCTQHMCNVKKQVQRLSKETNMVETTYEGIHNHP 90 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.6E-33 | 17 | 90 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.57E-28 | 24 | 91 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.128 | 27 | 92 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.7E-37 | 32 | 91 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.6E-26 | 33 | 90 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MNGLLDSSRD ISHKKMKNPR FAFRTKSDSD LLDDGYRWRK YGQKSVKNSL YPRSYYRCTQ 60 HMCNVKKQVQ RLSKETNMVE TTYEGIHNHP CEEHMQTLTP LLHQMQFLSK LIT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-25 | 22 | 89 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-25 | 22 | 89 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00317 | DAP | Transfer from AT2G46130 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 322266 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK117931 | 1e-135 | AK117931.1 Arabidopsis thaliana At2g46130 mRNA for putative WRKY transcription factor (WRKY43), complete cds, clone: RAFL19-12-A14. | |||
GenBank | BT004701 | 1e-135 | BT004701.1 Arabidopsis thaliana At2g46130 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002880217.1 | 1e-81 | probable WRKY transcription factor 43 isoform X1 | ||||
Swissprot | Q8GY11 | 2e-71 | WRK43_ARATH; Probable WRKY transcription factor 43 | ||||
TrEMBL | D7LDW5 | 2e-80 | D7LDW5_ARALL; WRKY DNA-binding protein 43 | ||||
STRING | fgenesh1_pm.C_scaffold_4002323 | 4e-81 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46130.1 | 9e-74 | WRKY DNA-binding protein 43 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 322266 |
Entrez Gene | 9318118 |
Publications ? help Back to Top | |||
---|---|---|---|
|