PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus

Family

SBP

Protein Properties

Length: 141aa MW: 15997.7 Da PI: 7.4766

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
30190.m011329	genome	JCVI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	130.9	4.4e-41	57	133	2	78
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cq+e+C+ d++eak+yhrrhkvCe+h+kap vlvsg++qrfCqqCsrfhe+sefD++krsCrrrLa+hnerrrk+++ 30190.m011329 57 CQAENCTFDMTEAKRYHRRHKVCEHHAKAPCVLVSGIHQRFCQQCSRFHEVSEFDDTKRSCRRRLAGHNERRRKSSS 133 **************************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	1.5E-58	1	141	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	1.6E-32	50	118	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	31.436	54	131	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	7.59E-38	55	135	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	2.9E-31	57	130	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009911	Biological Process	positive regulation of flower development
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010229	Biological Process	inflorescence development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046872	Molecular Function	metal ion binding

Sequence ? help Back to Top
Protein Sequence Length: 141 aa Download sequence Send to blast
MATSKAEGKR SLKEMEDDEE EEDDEDGGCG LGFSEDEKKR KGKKGSSASG SMPPVSCQAE 60 NCTFDMTEAK RYHRRHKVCE HHAKAPCVLV SGIHQRFCQQ CSRFHEVSEF DDTKRSCRRR 120 LAGHNERRRK SSSEYHGEGS I

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	2e-36	48	130	2	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00290	DAP	Transfer from AT2G33810	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	30190.m011329

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002509450.1	3e-99	squamosa promoter-binding-like protein 3
Swissprot	Q38741	3e-47	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	B9RBB6	8e-98	B9RBB6_RICCO; Squamosa promoter-binding-like protein
STRING	XP_002509450.1	1e-98	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	8e-41	squamosa promoter binding protein-like 3

Link Out ? help Back to Top
Phytozome	30190.m011329
Entrez Gene	8258445

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]