![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 30147.m014041 | ||||||||
Common Name | RCOM_1512990 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 100aa MW: 11490.4 Da PI: 10.3491 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.2 | 7.7e-18 | 17 | 61 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT+eEd +++ +v ++G+g+W++ +++ g++R++k+c++rw +yl 30147.m014041 17 WTAEEDAKILAYVSKHGTGNWTALPKKAGLRRCGKSCRLRWTNYL 61 *******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.631 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.6E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.21E-11 | 17 | 61 | No hit | No description |
SuperFamily | SSF46689 | 1.16E-22 | 17 | 89 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.0E-16 | 17 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-7 | 65 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MVRPPCCDKL NMKRALWTAE EDAKILAYVS KHGTGNWTAL PKKAGLRRCG KSCRLRWTNY 60 LRPHLKHDSF TPQEEELIVR LHAAIGSRLA ITHSYLQFTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-15 | 11 | 90 | 4 | 82 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Required for anther development and early tapetal function during microspore maturation (PubMed:18397379, PubMed:21957980). Regulates callose dissolution required for microspores release from the tetrads (PubMed:18397379). {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 30147.m014041 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM034731 | 3e-37 | KM034731.1 Jatropha curcas clone JcMYB111 MYB family protein gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015579165.1 | 8e-62 | transcription factor MYB35 | ||||
Refseq | XP_025014638.1 | 8e-62 | transcription factor MYB35 | ||||
Swissprot | Q9LSI7 | 6e-47 | MYB35_ARATH; Transcription factor MYB35 | ||||
TrEMBL | B9R915 | 3e-69 | B9R915_RICCO; R2r3-myb transcription factor, putative | ||||
STRING | XP_002511490.1 | 5e-70 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2942 | 34 | 74 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28470.1 | 3e-49 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 30147.m014041 |
Publications ? help Back to Top | |||
---|---|---|---|
|