PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus

Family

MYB

Protein Properties

Length: 214aa MW: 24281 Da PI: 7.9701

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
30055.m001589	genome	JCVI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	28.6	3.2e-09	9	54	3	46
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46 +W+ Ed+l+ +a ++ + +W++Ia++++ g+++ ++k+++ + 30055.m001589 9 SWSRLEDKLFERALVVFPEEtpdRWEKIASHVP-GKSRFDVKEHYED 54 7***************99*********.*********76 PP
2	Myb_DNA-binding	43.2	9.4e-14	109	153	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + +++G+g+W++I+r Rt+ q+ s+ qky 30055.m001589 109 PWTEEEHRLFLIGLQRYGKGDWRSISRNAVVSRTPTQVASHAQKY 153 8*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51293	8.055	5	60	IPR017884	SANT domain
SMART	SM00717	8.6E-9	6	58	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.05E-11	6	56	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.8E-5	8	55	IPR009057	Homeodomain-like
Pfam	PF00249	5.6E-8	9	55	IPR001005	SANT/Myb domain
CDD	cd00167	9.33E-8	9	56	No hit	No description
PROSITE profile	PS51294	18.513	102	158	IPR017930	Myb domain
SuperFamily	SSF46689	4.56E-17	104	159	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.1E-17	106	156	IPR006447	Myb domain, plants
SMART	SM00717	8.1E-10	106	156	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.8E-12	106	152	IPR009057	Homeodomain-like
CDD	cd00167	4.00E-9	109	154	No hit	No description
Pfam	PF00249	2.3E-11	109	153	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 214 aa Download sequence Send to blast
MIGASPSSSW SRLEDKLFER ALVVFPEETP DRWEKIASHV PGKSRFDVKE HYEDLVYDVK 60 EIDSGRVELP SYGDQFGLGW GAAESGTSQV WFGSKGKEKE TSERRKGVPW TEEEHRLFLI 120 GLQRYGKGDW RSISRNAVVS RTPTQVASHA QKYFLRLNSV KKEKKRPSIH DITTSANSVP 180 PQSNDHNWAD YMDPKPYPDH GSPSSAFHGF GFPV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2cjj_A	2e-15	10	72	11	73	RADIALIS
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	159	166	VKKEKKRP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269\|PubMed:26243618}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	30055.m001589

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:26243618}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002523835.1	1e-157	transcription factor SRM1
Swissprot	Q9FNN6	1e-63	SRM1_ARATH; Transcription factor SRM1
TrEMBL	B9SCW6	1e-156	B9SCW6_RICCO; DNA binding protein, putative
STRING	XP_002523835.1	1e-157	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF6068	32	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G04760.1	5e-71	MYB family protein

Link Out ? help Back to Top
Phytozome	30055.m001589
Entrez Gene	8271947

Publications ? help Back to Top
Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Chen YS, et al. Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis. Plant Mol. Biol., 2017. 93(3): p. 299-311 [PMID:27866313]