PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30027.m000837
Common NameRCOM_1255960
Organism
Ricinus communis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB_related
Protein Properties Length: 88aa    MW: 10215.8 Da    PI: 10.4372
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30027.m000837genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.4e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+  ++  g++R++k+c++rw +yl
    30027.m000837 14 KGPWTAEEDQKLIDYIQKHGHGRWRILPKNAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-28564IPR009057Homeodomain-like
PROSITE profilePS5129425.967965IPR017930Myb domain
SMARTSM007176.6E-161363IPR001005SANT/Myb domain
PfamPF002499.8E-181461IPR001005SANT/Myb domain
SuperFamilySSF466895.13E-251588IPR009057Homeodomain-like
CDDcd001674.74E-121661No hitNo description
PROSITE profilePS500904.0666288IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.1E-86588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGKSSCCDKN GLKKGPWTAE EDQKLIDYIQ KHGHGRWRIL PKNAGLKRCG KSCRLRWTNY  60
LRPDIKRGKF SFEEEQAIIQ MHSVLGNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-191288580B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}.
UniProtTranscription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:22575450, ECO:0000269|PubMed:25060192}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30027.m000837
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}.
UniProtINDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:25060192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025014328.15e-60LOW QUALITY PROTEIN: transcription factor MYB102-like
SwissprotQ9LDR84e-54MY102_ARATH; Transcription factor MYB102
SwissprotQ9M0J51e-54MYB41_ARATH; Transcription factor MYB41
TrEMBLA0A438FKH01e-55A0A438FKH0_VITVI; Transcription factor MYB102
TrEMBLB9SIG03e-59B9SIG0_RICCO; R2r3-myb transcription factor, putative
TrEMBLF6H2F31e-55F6H2F3_VITVI; Uncharacterized protein
STRINGVIT_19s0014g03820.t012e-56(Vitis vinifera)
STRINGXP_002525779.15e-60(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.14e-57myb domain protein 41
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]
  4. Zhu L,Guo J,Ma Z,Wang J,Zhou C
    Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis.
    Biomolecules, 2019.
    [PMID:29880735]