PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus

Family

MIKC_MADS

Protein Properties

Length: 205aa MW: 23401.3 Da PI: 8.2091

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
29907.m000663	genome	JCVI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	76.6	1.8e-24	9	56	1	48
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 krien rqvtf+kRr g+lKKA+ELSvLCdae+ + ifs +gkly+ 29907.m000663 9 KRIENPVHRQVTFCKRRSGLLKKAKELSVLCDAEIGLFIFSAHGKLYD 56 79********************************************97 PP
2	K-box	61.6	3e-21	89	178	11	100
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 ++ ++e++ Lk+eie Lq+ +RhllG + +++l eL Le++Le + +iRs+K+e++ ++i+ l++ke l+ +n++L+ k+ee 29907.m000663 89 MQQPLDAKEEISMLKQEIEILQKGLRHLLGGGAAEMTLDELLILEKNLEIWIYHIRSTKMEIMAKEIQLLRNKEGILKAANQYLQDKIEE 178 444556799******************************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.674	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	8.2E-35	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.49E-27	1	76	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.83E-39	2	76	No hit	No description
PRINTS	PR00404	6.1E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.6E-22	10	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.1E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.1E-27	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	12.564	92	182	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.6E-21	94	176	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0048364	Biological Process	root development
GO:0055114	Biological Process	oxidation-reduction process
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0032440	Molecular Function	2-alkenal reductase [NAD(P)] activity
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 205 aa Download sequence Send to blast
MARGKVQMKR IENPVHRQVT FCKRRSGLLK KAKELSVLCD AEIGLFIFSA HGKLYDLATK 60 GTMSGLIERY MNATGGNSLQ AEDKAKETMQ QPLDAKEEIS MLKQEIEILQ KGLRHLLGGG 120 AAEMTLDELL ILEKNLEIWI YHIRSTKMEI MAKEIQLLRN KEGILKAANQ YLQDKIEENV 180 DITNFAPMTT NFPYPLTIQN EIFQF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	8e-15	1	59	1	59	MEF2 CHIMERA
6byy_B	8e-15	1	59	1	59	MEF2 CHIMERA
6byy_C	8e-15	1	59	1	59	MEF2 CHIMERA
6byy_D	8e-15	1	59	1	59	MEF2 CHIMERA
6bz1_A	8e-15	1	59	1	59	MEF2 CHIMERA
6bz1_B	8e-15	1	59	1	59	MEF2 CHIMERA
6bz1_C	8e-15	1	59	1	59	MEF2 CHIMERA
6bz1_D	8e-15	1	59	1	59	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269\|PubMed:18203871}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	29907.m000663

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin in root phloem. {ECO:0000269\|PubMed:18203871}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002526423.1	1e-151	agamous-like MADS-box protein AGL12
Swissprot	Q38841	8e-85	AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBL	B9SKA4	1e-149	B9SKA4_RICCO; Mads box protein, putative
STRING	XP_002526423.1	1e-150	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF7566	31	44

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G71692.1	4e-87	AGAMOUS-like 12

Link Out ? help Back to Top
Phytozome	29907.m000663
Entrez Gene	8263251

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Pacheco-Escobedo MA, et al. Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm. Ann. Bot., 2018. [PMID:27358290] García-Cruz KV, et al. The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components. Ann. Bot., 2018. [PMID:27474508]