PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

29706.m001288

Common Name

RCOM_0652920

Organism

Ricinus communis

Taxonomic ID

3988

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus

Family

MYB_related

Protein Properties

Length: 106aa MW: 12249.4 Da PI: 10.5843

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
29706.m001288	genome	JCVI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.9	6.3e-20	23	70	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l+++++ +G ++Wk +a++ g++R++k+c++rw++yl 29706.m001288 23 KGSWTPEEDRKLAEVIAIHGAKRWKMVAAKAGLNRCGKSCRLRWLNYL 70 799********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.3E-23	18	73	IPR009057	Homeodomain-like
PROSITE profile	PS51294	26.757	18	74	IPR017930	Myb domain
SMART	SM00717	3.3E-16	22	72	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-18	23	70	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	7.18E-22	24	98	IPR009057	Homeodomain-like
CDD	cd00167	4.74E-12	25	70	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.9E-7	74	97	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MKRETKTIEP AMASLPIKQE VNKGSWTPEE DRKLAEVIAI HGAKRWKMVA AKAGLNRCGK 60 SCRLRWLNYL RPNIKRGNIS DQEEDLILRL HKLLGNRSFL MTDNFC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-17	23	97	7	80	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269\|PubMed:11437443, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15668208, ECO:0000269\|PubMed:15728674}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	29706.m001288

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM034681	4e-43	KM034681.1 Jatropha curcas clone JcMYB061 MYB family protein gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002521333.2	2e-65	transcription factor WER
Swissprot	P10290	3e-32	MYBC_MAIZE; Anthocyanin regulatory C1 protein
Swissprot	Q96276	2e-32	MYB23_ARATH; Transcription factor MYB23
TrEMBL	B9S5R4	8e-73	B9S5R4_RICCO; R2r3-myb transcription factor, putative
STRING	XP_002521333.1	1e-73	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2148	32	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G40330.1	1e-34	myb domain protein 23

Link Out ? help Back to Top
Phytozome	29706.m001288

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Khosla A, et al. HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23. Plant Cell, 2014. 26(5): p. 2184-2200 [PMID:24824485] Yu D, et al. RPN1a, a subunit of the 26S proteasome, controls trichome development in Arabidopsis. Plant Physiol. Biochem., 2015. 88: p. 82-8 [PMID:25676129] Lung SC, et al. Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors. New Phytol., 2018. 218(1): p. 183-200 [PMID:29288621] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]