PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

29631.m001031

Common Name

RCOM_0528450

Organism

Ricinus communis

Taxonomic ID

3988

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus

Family

MYB_related

Protein Properties

Length: 88aa MW: 10546.9 Da PI: 8.2308

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
29631.m001031	genome	JCVI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.9	8.4e-17	11	56	3	48
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT+eEd l++++++ G g+W+ I++ g++R++k+c++rw++yl 29631.m001031 11 LWTEEEDRTLLEYIRENGRGRWNHIPQLTGLKRCGKSCRLRWLNYL 56 5********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.206	4	60	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-21	5	59	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-13	8	58	IPR001005	SANT/Myb domain
Pfam	PF00249	4.9E-16	11	56	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.28E-22	11	83	IPR009057	Homeodomain-like
CDD	cd00167	5.30E-10	12	56	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.4E-8	60	83	IPR009057	Homeodomain-like
PROSITE profile	PS51294	7.719	61	88	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MKGENEYKKS LWTEEEDRTL LEYIRENGRG RWNHIPQLTG LKRCGKSCRL RWLNYLNPSI 60 KRGDFSEEEE DLIIRLHNLL GNSSSTHW

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	9e-15	6	82	24	99	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:11585796, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16207757}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	29631.m001031

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:16176989}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025014255.1	1e-53	transcription factor WER
Swissprot	Q9SEI0	2e-37	WER_ARATH; Transcription factor WER
TrEMBL	B9SHA9	5e-57	B9SHA9_RICCO; R2r3-myb transcription factor, putative
STRING	XP_002525378.1	8e-58	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	1e-39	myb domain protein 66

Link Out ? help Back to Top
Phytozome	29631.m001031

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Cheng Y, et al. Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases. Elife, 2018. [PMID:24771765] Kiefer CS, et al. Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity. Development, 2015. 142(5): p. 1022 [PMID:25715402] Kwak SH,Song SK,Lee MM,Schiefelbein J TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(12): p. e1103407 [PMID:26451798] Zhu Y, et al. The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development. Plant Cell, 2017. 29(2): p. 260-276 [PMID:28138017] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Mira MM, et al. Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit. J. Exp. Bot., 2017. 68(20): p. 5653-5668 [PMID:29059380] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]