 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
29278.m000136 |
| Common Name | RCOM_0415140 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
| Family |
MYB_related |
| Protein Properties |
Length: 57aa MW: 6703.61 Da PI: 9.2526 |
| Description |
MYB_related family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| 29278.m000136 | genome | JCVI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 39.3 | 1.5e-12 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
rg WT+eEd +l +++q+G+++W++I++ g
29278.m000136 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAG 45
89**************************9988 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription factor that binds to the DNA sequence 5'-CCAACC-3'. Regulates directly PME5, UND and GLOX1 (PubMed:21673079). Essential for tapetum development in anthers and microsporogenesis (PubMed:12848824, PubMed:21673079). Regulates the timing of tapetal programmed cell death (PCD) which is critical for pollen development. May act through the activation of UND, encoding an A1 aspartic protease (PubMed:21673079). Required for anther development by regulating tapetum development, callose dissolution and exine formation. Acts upstream of A6 and FAR2/MS2, two genes required for pollen exine formation (PubMed:17727613). Negatively regulates trichome endoreduplication and trichome branching (PubMed:12848824). {ECO:0000269|PubMed:12848824, ECO:0000269|PubMed:17727613, ECO:0000269|PubMed:21673079}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | KM034741 | 2e-43 | KM034741.1 Jatropha curcas clone JcMYB122 MYB family protein gene, complete cds. |
| Publications
? help Back to Top |
- Li SF,Iacuone S,Parish RW
Suppression and restoration of male fertility using a transcription factor.
Plant Biotechnol. J., 2007. 5(2): p. 297-312
[PMID:17309685] - Qian H, et al.
Trace concentrations of imazethapyr (IM) affect floral organs development and reproduction in Arabidopsis thaliana: IM-induced inhibition of key genes regulating anther and pollen biosynthesis.
Ecotoxicology, 2015. 24(1): p. 163-71
[PMID:25348600] - Xiong SX, et al.
The transcription factors MS188 and AMS form a complex to activate the expression of CYP703A2 for sporopollenin biosynthesis in Arabidopsis thaliana.
Plant J., 2016. 88(6): p. 936-946
[PMID:27460657] - Verma N,Burma PK
Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum.
Plant J., 2017. 92(3): p. 481-494
[PMID:28849604] - Li DD,Xue JS,Zhu J,Yang ZN
Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana.
Front Plant Sci, 2017. 8: p. 1559
[PMID:28955355]
|
