 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
29140 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
Family |
M-type_MADS |
Protein Properties |
Length: 117aa MW: 13569.5 Da PI: 10.0501 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
29140 | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 81.7 | 4.6e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
+ri +++nrqvtf+kR+ng++KKA ELSvLCd ++a++i+ s+ kly yss
29140 9 ERIVDERNRQVTFTKRKNGLMKKAMELSVLCDCDIALVIYNSNEKLYQYSS 59
6899*********************************************96 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0009553 | Biological Process | embryo sac development |
GO:0010094 | Biological Process | specification of carpel identity |
GO:0010582 | Biological Process | floral meristem determinacy |
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
GO:0048455 | Biological Process | stamen formation |
GO:0048459 | Biological Process | floral whorl structural organization |
GO:0048509 | Biological Process | regulation of meristem development |
GO:0048833 | Biological Process | specification of floral organ number |
GO:0080060 | Biological Process | integument development |
GO:0080112 | Biological Process | seed growth |
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm |
GO:0090376 | Biological Process | seed trichome differentiation |
GO:0003677 | Molecular Function | DNA binding |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0046983 | Molecular Function | protein dimerization activity |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | CP000581 | 0.0 | CP000581.1 Ostreococcus lucimarinus CCE9901 chromosome 1, complete sequence. |