PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

CAMTA

Protein Properties

Length: 73aa MW: 8917.25 Da PI: 10.6018

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
28388	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	120.2	9.6e-38	1	67	39	105
CG-1 39 liLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeee 105 l+L++rk +ryfrkDG++w+kkkdgktv+E+he+LKvg+v++l+cyYah+een +fqrr+ywlLe 28388 1 LFLFDRKALRYFRKDGHNWRKKKDGKTVKEAHERLKVGSVNALHCYYAHGEENMNFQRRSYWLLEGY 67 69**************************************************************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	50.467	1	73	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	3.6E-18	1	67	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	4.8E-31	1	66	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 73 aa Download sequence Send to blast
LFLFDRKALR YFRKDGHNWR KKKDGKTVKE AHERLKVGSV NALHCYYAHG EENMNFQRRS 60 YWLLEGYVSR RIV

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002989427.2	4e-41	calmodulin-binding transcription activator 3
Refseq	XP_024514944.1	4e-41	calmodulin-binding transcription activator 3
Swissprot	Q6NPP4	9e-37	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	D8QUK2	1e-46	D8QUK2_SELML; Uncharacterized protein (Fragment)
STRING	EFJ09519	2e-47	(Selaginella moellendorffii)
STRING	EFJ36307	2e-47	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP562	15	65

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64220.2	4e-39	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Link Out ? help Back to Top
Phytozome	28388
Entrez Gene	9651101 \| 9661981

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]