PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 227538 | ||||||||
Common Name | SELMODRAFT_227538, SELMODRAFT_229209 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 146aa MW: 15998 Da PI: 4.6853 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 76.8 | 3.1e-24 | 8 | 97 | 3 | 92 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 ++d lP a +++i+k++lP + ++++da++++ +c +efi +++se+++ c++e+++ti+++ +l al lGf +y+e++++ +++r+ 227538 8 KEDVSLPKATMTKIIKEMLPPEVRVARDAQDLLVDCCVEFINLISSESNEICNKEEKRTIAPEHVLKALEILGFGEYIEEVHAAYEQHRN 97 67999****************************************************************************998888886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.8E-40 | 5 | 142 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.0E-35 | 9 | 139 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.0E-22 | 12 | 76 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MDAASRSKED VSLPKATMTK IIKEMLPPEV RVARDAQDLL VDCCVEFINL ISSESNEICN 60 KEEKRTIAPE HVLKALEILG FGEYIEEVHA AYEQHRNETL DSPKAGGKWG KEAGSGMTEE 120 EAIAAQQRMF AEARARMNSG GTQSS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 6e-39 | 1 | 134 | 4 | 133 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002965285.2 | 1e-104 | protein Dr1 homolog | ||||
Refseq | XP_024516159.1 | 1e-104 | protein Dr1 homolog | ||||
Swissprot | P49592 | 1e-75 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | D8R2T0 | 1e-103 | D8R2T0_SELML; Uncharacterized protein | ||||
STRING | EFJ12470 | 1e-104 | (Selaginella moellendorffii) | ||||
STRING | EFJ34123 | 1e-104 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP3449 | 17 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23090.2 | 5e-78 | nuclear factor Y, subunit B13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 227538 |
Entrez Gene | 9659855 | 9660490 |
Publications ? help Back to Top | |||
---|---|---|---|
|