|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
19633 |
Common Name | SELMODRAFT_19633 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
Family |
Dof |
Protein Properties |
Length: 59aa MW: 7034.96 Da PI: 9.972 |
Description |
Dof family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
19633 | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | zf-Dof | 66.2 | 5.5e-21 | 12 | 59 | 3 | 50 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvP 50
e+ + cprC s +tkfCy nn sqPry C +C+r +tkGG +r vP
19633 12 EEPTICPRCSSIDTKFCYNNNKKASQPRYRCNSCKRKFTKGGRIRFVP 59
67889****************************************999 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}. |
Orthologous Group
? help Back to Top |
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP38 | 17 | 445 |