![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 18196 | ||||||||
Common Name | SELMODRAFT_108871 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 104aa MW: 12415.1 Da PI: 5.9933 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 63 | 4.3e-20 | 15 | 68 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k+++++ eq+++Le+ Fe ++++ +++ +LAk+lgL+ rqV vWFqNrRa++k 18196 15 KKRRLSVEQVKALEKNFEIENKLEPDRKIQLAKELGLQPRQVAVWFQNRRARWK 68 456899***********************************************9 PP | |||||||
2 | HD-ZIP_I/II | 131.4 | 3.5e-42 | 14 | 104 | 1 | 91 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 ekkrrls eqvk+LE++Fe e+kLep+rK +la+eLglqprqvavWFqnrRAR+ktkqlEkdy+ Lk++yd lk++ L ke ++L++e+ 18196 14 EKKRRLSVEQVKALEKNFEIENKLEPDRKIQLAKELGLQPRQVAVWFQNRRARWKTKQLEKDYDLLKSEYDDLKASYVDLAKERDKLQAEV 104 69*************************************************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 17.556 | 10 | 70 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.88E-20 | 10 | 72 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 3.6E-18 | 13 | 74 | IPR001356 | Homeobox domain |
CDD | cd00086 | 3.66E-15 | 15 | 71 | No hit | No description |
Pfam | PF00046 | 3.0E-17 | 15 | 68 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 6.7E-22 | 17 | 77 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 1.6E-6 | 41 | 50 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 45 | 68 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 1.6E-6 | 50 | 66 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 5.0E-11 | 70 | 104 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001558 | Biological Process | regulation of cell growth | ||||
GO:0009637 | Biological Process | response to blue light | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009965 | Biological Process | leaf morphogenesis | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
DDDLCDESIA QHVEKKRRLS VEQVKALEKN FEIENKLEPD RKIQLAKELG LQPRQVAVWF 60 QNRRARWKTK QLEKDYDLLK SEYDDLKASY VDLAKERDKL QAEV |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 62 | 70 | RRARWKTKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00323 | DAP | Transfer from AT3G01470 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002970538.2 | 7e-67 | homeobox-leucine zipper protein HAT5 | ||||
Refseq | XP_002978617.2 | 6e-67 | homeobox-leucine zipper protein HAT5 | ||||
Refseq | XP_024531166.1 | 7e-67 | homeobox-leucine zipper protein HAT5 | ||||
Refseq | XP_024539277.1 | 6e-67 | homeobox-leucine zipper protein HAT5 | ||||
Swissprot | Q02283 | 5e-41 | HAT5_ARATH; Homeobox-leucine zipper protein HAT5 | ||||
TrEMBL | D8RGY1 | 6e-67 | D8RGY1_SELML; Uncharacterized protein (Fragment) | ||||
TrEMBL | D8S5J1 | 8e-67 | D8S5J1_SELML; Uncharacterized protein | ||||
STRING | EFJ20603 | 1e-67 | (Selaginella moellendorffii) | ||||
STRING | EFJ28668 | 1e-67 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP129 | 16 | 189 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01470.1 | 2e-43 | homeobox 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 18196 |
Entrez Gene | 9653632 |
Publications ? help Back to Top | |||
---|---|---|---|
|