![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 1400010209 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 88aa MW: 9683.17 Da PI: 10.0261 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 39.2 | 1.3e-12 | 9 | 45 | 13 | 49 |
RWP-RK 13 yFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49 + l+ dAA eLg ++T+ K++ Rq+G++RWP R+ 1400010209 9 HALLSADDAAIELGFGTTTFKKRLRQLGVRRWPGRQF 45 5667889****************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 11.684 | 1 | 68 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 2.4E-11 | 10 | 45 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MGLDCVYAHA LLSADDAAIE LGFGTTTFKK RLRQLGVRRW PGRQFAGVLK CYEYIVTVLN 60 VRKATRGSCV FSKATTEPRS NDRLTDA* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022841348.1 | 6e-38 | RWP-RK domain | ||||
TrEMBL | A0A1Y5ICM5 | 6e-58 | A0A1Y5ICM5_OSTTA; Uncharacterized protein | ||||
STRING | A0A096PBT9 | 2e-37 | (Ostreococcus tauri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP13314 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G59580.2 | 7e-08 | Nin-like family protein |