![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 101484 | ||||||||
| Common Name | SELMODRAFT_101484, SELMODRAFT_132315 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 89aa MW: 9967.53 Da PI: 10.1779 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 62.3 | 9.7e-20 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+WT+eEd +l+ +++q+G+g+W+t +++ g+ R++k+c++rw +yl
101484 14 RGPWTPEEDAKLLACIAQHGTGSWRTLPKKAGLQRCGKSCRLRWTNYL 61
89********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 25.716 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 5.3E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.5E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.49E-23 | 15 | 87 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.19E-11 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-7 | 65 | 87 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MGRAPCCEKD SVKRGPWTPE EDAKLLACIA QHGTGSWRTL PKKAGLQRCG KSCRLRWTNY 60 LRPDLKHGRF TDHEEQLIVK LHAALGSR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 8e-16 | 14 | 88 | 7 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Essential for tapetum development in anthers and microsporogenesis. May regulate the timing of tapetal programmed cell death (PCD) which is critical for pollen development. {ECO:0000269|PubMed:22086333}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002974331.2 | 2e-58 | transcription factor MYB80 | ||||
| Refseq | XP_002990860.2 | 2e-58 | transcription factor MYB80 | ||||
| Swissprot | Q7XQN1 | 5e-45 | MYB80_ORYSJ; Transcription factor MYB80 | ||||
| TrEMBL | A0A2K1J4Q5 | 2e-56 | A0A2K1J4Q5_PHYPA; Uncharacterized protein | ||||
| TrEMBL | A0A2K1JHJ1 | 1e-56 | A0A2K1JHJ1_PHYPA; Uncharacterized protein | ||||
| TrEMBL | A9RYY7 | 8e-58 | A9RYY7_PHYPA; Predicted protein (Fragment) | ||||
| TrEMBL | D8RTQ7 | 1e-58 | D8RTQ7_SELML; Uncharacterized protein | ||||
| STRING | PP1S36_198V6.1 | 5e-57 | (Physcomitrella patens) | ||||
| STRING | PP1S65_211V6.1 | 1e-58 | (Physcomitrella patens) | ||||
| STRING | EFJ08133 | 2e-59 | (Selaginella moellendorffii) | ||||
| STRING | EFJ24553 | 2e-59 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G56110.1 | 1e-46 | myb domain protein 103 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 101484 |
| Entrez Gene | 9636425 | 9659436 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




