PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PNH12158.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Tetrabaenaceae; Tetrabaena
Family SBP
Protein Properties Length: 186aa    MW: 20504.8 Da    PI: 9.3858
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PNH12158.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP117.38.1e-3769145177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +CqvegC +dls+ k y++r++vCe h k+ v++v+g+  rfCqqC+rfhel+efD +krsCr rL++hn+rrrk+ 
  PNH12158.1  69 VCQVEGCGHDLSNEKGYYQRYRVCEPHLKMLVIAVEGKDCRFCQQCGRFHELTEFDGNKRSCRARLQQHNARRRKRD 145
                 6*************************************************************************985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    
MAGFAEAFGV ESSAWSPSNY SWEPSSLTPE RRTSGPASSD RDQSLGPLPG SWHCQGPPKS  60
TRLSKGPLVC QVEGCGHDLS NEKGYYQRYR VCEPHLKMLV IAVEGKDCRF CQQCGRFHEL  120
TEFDGNKRSC RARLQQHNAR RRKRDPLDTS RKDAGAARKA KAAAHPRSDS SNDAVRSGGM  180
AHSADK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.13e-28SBP family protein