PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PNH10935.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Tetrabaenaceae; Tetrabaena
Family SBP
Protein Properties Length: 61aa    MW: 6877.88 Da    PI: 5.7813
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PNH10935.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP45.71.8e-141860345
                SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TT CS
         SBP  3 qvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqq 45
                +vegC  d+s  k y+rr+ vCe+h +a + lv+g+ qrfCqq
  PNH10935.1 18 EVEGCLRDMSLEKVYYRRYSVCEAHLRALELLVDGRIQRFCQQ 60
                69****************************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    
MDGVEPARGP SSTAGGMEVE GCLRDMSLEK VYYRRYSVCE AHLRALELLV DGRIQRFCQQ  60
V
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.11e-11SBP family protein