PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PNH07637.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Tetrabaenaceae; Tetrabaena
Family SBP
Protein Properties Length: 1509aa    MW: 158446 Da    PI: 7.4772
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PNH07637.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP52.31.6e-16414484275
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                 Cqve C+++l e    ++rh++C+ h  a++v ++g+ qrfCq C r h++++f+ ++r Cr r +   + r++
  PNH07637.1 414 CQVEMCSQQLVE---PYERHRICQEHYWAAEVSHEGMPQRFCQLCCRLHAVDDFEADQRVCRARCNIAEQPRKR 484
                 ********9976...4789*********************************************9888777776 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1509 aa     Download sequence    
MEPAPPAAPC LPLNGAALQQ HSAPQLSAPP AQQQQQQQRG HHQNRLVVEH EPQPHEQHQQ  60
HYLHQHHLAH QGQGPHEYEY EQQMQPYSPQ GLQQQQQQRV PGHAPHLLDS MPSHPPAMPA  120
APAQGWDGRH AASRGPDVDQ QQQQPGHQQQ QQQHAGSPEV ANSCDASGSH HHHHFFSQQQ  180
HQQQQHGDDD MDDSLDDPRY GDEGDGSPQL HPHFGGRQQQ QQPLQKHGSS QQLQKHGSSQ  240
QLQKHGSSQQ LQKHGSSQQL LIQALGSQAH RAAAAAGAAA VAAAGGGTSG ARRGNAMQGG  300
GTSPHSHPSG TAISGTIGSG GGGGGGGCHF QDDAISGAAA AELRGGRDRE ADADHESRPR  360
HVLDVLGRAS PGELVVIGSQ YPRQGTAARE PAGRAVPAPP ANARNALAPA RALCQVEMCS  420
QQLVEPYERH RICQEHYWAA EVSHEGMPQR FCQLCCRLHA VDDFEADQRV CRARCNIAEQ  480
PRKRGRPDEA AAGGGGDDMA VEYGSHEAPV AIALGNGVTW TPAPQPQQKQ TQTALRDSSI  540
GSAGLAAPGG AGHHQPQAGL ALGGPMRPQC RSEGAGTPPC EGGGGGQQPQ QVGPSQQQQL  600
LQLEQLKRQL HHLQQQQQQQ QQQQQQQQQQ PAVLYDAFGD AQDASAPARP GTAPAAQQTQ  660
PHPDGAPSPG QPRPRSSPQN MLGTADPGPA QRRPGPRPMS CSSGYPQSPH PLPNLHNARA  720
DPSPPRTRHR LFHGQGQFPD LEGAAGPPLP PKGVAADGGG GGAAGAYGRP GRAGAAAAAP  780
PQPAQQQLQQ LQHAGGAPAT APPPSWPGQQ QGPQQHAGPQ QAAPGGALLH LQTARARPSS  840
APSHMSTTAG EGQEQGQQPS PLPGAMVGSA PAAAVAAASP LQQPAAGGFG VSPARPAHAY  900
GAAQGQAEAG RPHRGPQGVP PAPRQRRPQQ QQQQQQQKPP QPQQPYDPHT GDSPGQPPLR  960
QPPAAAAPLQ QPHPAAQRQQ HPGQQGPLHL RLQPDAPPHQ HQQPVAAATF GRLSGPLFPQ  1020
QPATQAPAAP APLLQRQPSA SESTIVDSVM HPHADPRSPD PHDGGGGGGR QNPAPLAAAS  1080
PPQWQPQQAL RRAPEEGQRG RAAGPAMGGL QAPPLAQVQQ QWAGGVFGGG EQQQQHQQQA  1140
AHQQQQQLLQ QQSRQQQQQQ QLLLQQQQMQ QQQIQQQQIQ QQQMQAPRPA PYEVTPQQQQ  1200
QQRAAAAGGQ PGPVAGAAAA GQAGVGPGGA AAAMQQQQQQ QAEAAQQQRQ QYLFSMSAAA  1260
HAAQLQQQQL QTGSPYAAQP HSADPASQQH PHQQQQQHHQ QQQFSGVAAR GRGTDGGAGG  1320
AQPSPPQMPQ MPPPAHHADT TRGGPPEHHH PPKEAHAGGM SGMLSLMHHQ HLGLYPQPQL  1380
QHASSAPPGG YDTSTAAAAG PPLQQHLSHH HRQPSGGGAA SLDRRLTRDL ARTLRISVNG  1440
CAASFGELPN VSNGLFDSGL ISPNTELFNI LNTGVGGDDA TGPMMDLLGG MPGESAFEDT  1500
ANTNALAKM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.12e-11SBP family protein