PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PNH04574.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Tetrabaenaceae; Tetrabaena
Family SBP
Protein Properties Length: 1871aa    MW: 184965 Da    PI: 8.2732
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PNH04574.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP83.33.1e-2640113275
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                  qv+gC +dls +k y+rr+++Ce h k+ + +++g+  rfCqqC+rfh ++ef+ +krsCrr L +   +rr 
  PNH04574.1  40 AQVKGCPVDLSLCKAYYRRFRICERHLKTLSLCIEGKASRFCQQCGRFHVIEEFEGNKRSCRRALLTRFYKRRN 113
                 59*************************************************************98777666665 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1871 aa     Download sequence    
MRKTGDGAAA AQPYMAKRWL DALQAPSPTR APPHAPPRAA QVKGCPVDLS LCKAYYRRFR  60
ICERHLKTLS LCIEGKASRF CQQCGRFHVI EEFEGNKRSC RRALLTRFYK RRNMSVPPEV  120
LPPPPPDSVL QAGARDTDPK PRSKVRSPPE PDPSQPPQRR KRGRPRAAPM DVQDLASGDV  180
PELEAGGGLH LLGAQPAVSP SRPFPTSAQQ HPQLLLHLQG IKTEPEQVRP WGVCVLRRRF  240
RLRAAGSGRG SCAGLQRRMG ARASAAARTP RPRVSGPCRS GSTSSGVGGG SGSGGDPPSA  300
HLRYGFNELG AQQPGQQPPG RLGEAGPGRA HGAGLGAGQV QVQQQQLLPL RGEGGLGAME  360
GRVPGAHGLL GDQLTHLHLQ QQQQQQQQRH PAGGPARPPF SPLRPGNSPS PEHGDDLRAR  420
APSRLQQPQL QPQQQRQQQN GHDSQSTPYG GGGGGMAPAW HLQQQRQVVE QGPGWGLAAG  480
AADVTANGSL PPGGGVRAET LSRLQRHMLL LQQPGDAAAP TAAVFDLATA VSGGGLANGG  540
GGGGLGGGGL CNGGGSGGLG GGGLGGSGGL GGGGGLGGSG GLGGDGGLGG GGSGGLAEQW  600
QRAGGAWGHG HGGVGGGGNG ILGGHMGCGS LSLAPTGGSV GVPAIGVQHG TADALELELL  660
SIASESLMAD QGAHAHLAYT GPASRPLGLD IGSAEPGALL CAAGLQLGAV GNGCGGGPAA  720
QGLVSELRGM RMVSGGSGRD GGGGGSTSGS GGWGGEASGE GADGAACGGG QLAFGALAGG  780
GHAATLLPHR HTSTASSGDA SAAGLTLVQQ LQLRALQQEQ QHLQHHHQQH QQQHHVSGSA  840
WQLGAAGALA GGSTAGPYGG GGIVEGPREG AGGGPGQLQL QFMQLQQQHQ QRLQLQQQQE  900
QEQQAQRMRQ LQQLHQQQQR HFQQQQQQQP SLKDAALALL AQGGAHATYS PPASLLERLS  960
IKIHKCRPEQ LSPDLASQLT DWLITADASV VQGFVRPGCT HLVVDLLYGD RERLMQALFG  1020
AEGSDPRDAA ATLARRVLGA PPDTGPTSDM HLQLGDSTGS LRSFTSGHTW GSTGAPFVPD  1080
VAAPAAGTPG DSPTAAAAAP HEAAPPASLT AAAPPPPPRP ASGAHPGGAP RGRRLSPEAS  1140
YAAAVAPPAG LVPAPRAAAA IAAALAAGED VEAAAAAATA AEIAATAAAA ARRARRGSRH  1200
RVPQYGDNSG GALVAANANA PLLEGPGATA LLPLSDPGLR HRRLEPEVLA AAEAAYNASL  1260
AASAAAGETP SPAAGSPAAR TQQQQHASPP APAPAPAGSA VAGASELRLD SYAAEAAGTR  1320
EAAAAVAVAV AAAAGEGGTR GAGAQGPIRR AEAVAVTLMR EQHKQQEEGV SARREAAAVA  1380
AAVAVVQRLG GGEGAARVDA RAALRRRQEQ QEQQERSRLR LRQQQQQLGV RARALLVFFC  1440
SRCGPAAGGA LGGWWLVLNF LLTADAAPAA PAAATGAAAA APGAPATTAD ADAAQGAADA  1500
SAAAAPPAAA KPAEGAAAAE PAAADAAAGA PVAEDARAAP NAPAAGGCSN PQLAFAALEE  1560
QVRAEGGGMG LLHHAVRSGC AETVALLLAA SRRAGAPLDV ARPGPYGVTA VHLAALLPYG  1620
GAAILDAIVD HAAATDGGGG DGGGAPAPWP SGPAAAAADA DGAGAASGSG GGAAANSGDL  1680
GMGGGSGAPG ALVAYEPRAA AGATSVLSQE QVEVGLGEEV EGVALARNAA ADAEAEASSA  1740
EGPLDIGVAF GSIASWVDGS SPHRAPSPAP SSGGVAADAV PTLKGAALYG TAVAAPAGGG  1800
AAAGLGGRGA SGGAAAYAAV AVAAAAVAAL WRVGGWAPML LALPLALLLA VLAGAVPWRR  1860
SCAGGGSLGA L
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.12e-17SBP family protein