PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PNH00394.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Tetrabaenaceae; Tetrabaena
Family SBP
Protein Properties Length: 188aa    MW: 20366.7 Da    PI: 9.4186
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PNH00394.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.58.4e-2474149278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 Cq+ +C  dls+ak y rr+ vCe h ka+ vl++g + rfCqqC +f  l++f  +krsC++r ++ n rrrk+++
  PNH00394.1  74 CQA-SCGRDLSDAKLYLRRYSVCEPHFKAECVLLAGGRFRFCQQCNKFQPLDNFTGSKRSCKSRSEDRNLRRRKQRT 149
                 775.7*********************************************************************975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    
MSVPPDQARA DAEAYANAAA AVAAAAAAGM GDHHNNLSQV LSLQHHVDHG DDSGGGQQER  60
RPRKLRKPND VARCQASCGR DLSDAKLYLR RYSVCEPHFK AECVLLAGGR FRFCQQCNKF  120
QPLDNFTGSK RSCKSRSEDR NLRRRKQRTD ERTNATDGDG DGGDTLPGRL LKGGHGLGGL  180
TLPSRAAL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15965ERRPRKL
2139145DRNLRRR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.17e-18SBP family protein