PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PNG99096.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Tetrabaenaceae; Tetrabaena
Family SBP
Protein Properties Length: 255aa    MW: 26425.3 Da    PI: 9.5368
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PNG99096.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP65.41.3e-207651573
                -HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
         SBP 15 keyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73
                + y+rrh vC++h+  p v+++g+e rfCqqC++f +l+ fD + rsCr rL++    +
  PNG99096.1  7 QPYFRRHLVCQTHAILPLVVLEGVEMRFCQQCAKFERLTAFDLSNRSCRLRLSRRMIAK 65
                57**************************************************9865444 PP

Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    
PTPSPPQPYF RRHLVCQTHA ILPLVVLEGV EMRFCQQCAK FERLTAFDLS NRSCRLRLSR  60
RMIAKQRAQM AKHAARSEQQ PHSQSPEEPL LHPLSLSLGL LQQQSDFPFT TAAAAAGAQQ  120
HQLLQRAAQG EGGGRGGGGS EEWLPGSAGS PQGSGSGLDG VSALGSGASG PQPALAVQRS  180
RERERDPEPE AMFKREADRG TASPDVGRPT SGAVQHTSSA AAAATAAAAG GRWDEGSRGG  240
GSGGRASGGG APPPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132139GGGRGGGG
2133140GGGRGGGG
3243250GGGRGGGG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.39e-11SBP family protein