PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID POO03155.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family BES1
Protein Properties Length: 339aa    MW: 36836.5 Da    PI: 9.124
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
POO03155.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822214.23.3e-66131521143
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                 ++++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc eAGw+ve+DGttyrkg+kpl   ++ag+s++++p +s++ s+ 
  POO03155.1  13 AAARRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCVEAGWTVEEDGTTYRKGCKPL-PIDVAGTSSRMTPYTSQNPSPL 110
                 5899************************************************************************.9********************* PP

      DUF822 100 ssalaspvesysaspksssfpspssldsislasaasllpvlsvl 143
                 ss+++sp++sy+ sp+sssfpsps+ld   +   ++l+p+l++ 
  POO03155.1 111 SSSFPSPIPSYQVSPSSSSFPSPSRLDGSYNP--SNLIPYLQNA 152
                 ***************************98665..7888888875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    
MTSDGATSAA AAAAARRKPS WRERENNRRR ERRRRAIAAK IYAGLRAQGN YNLPKHCDNN  60
EVLKALCVEA GWTVEEDGTT YRKGCKPLPI DVAGTSSRMT PYTSQNPSPL SSSFPSPIPS  120
YQVSPSSSSF PSPSRLDGSY NPSNLIPYLQ NAIPSNLPPL RISNSAPVTP PLSSPTSRNP  180
KPIPTWEAIA RQSMASFKYP FYAVSAPASP TRHQIHIPAA TIPECDESDT STVDSGQWVS  240
FQKFAPSAST MPTSPTFNLV KPAAQPISTS NVIPEAVRGA EFDFGGGQVK PWVGERIHEV  300
GMEMEMDDLE LKLGSSKAEV KASGGMQSIC LIKEREKDW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11635RRKPSWRERENNRRRERRRR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.31e-121BES1 family protein