PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON95816.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family BES1
Protein Properties Length: 137aa    MW: 16296.9 Da    PI: 10.8902
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON95816.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822159.91.7e-49274173
      DUF822  1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgs 73
                ++++r+ptwkErEnnkrRERrRRaiaakiyaGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrk +
  PON95816.1  2 TSGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKAY 74
                5899******************************************************************975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    
MTSGTRMPTW KERENNKRRE RRRRAIAAKI YAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKAYVSELLL LSVKMRRPGY RRADRRFILY TNAIDEQQRS QICRACVKVF  120
QFPKMPPRNR IFSPFNS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.13e-28BES1 family protein