PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PON92078.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Trema
Family BES1
Protein Properties Length: 700aa    MW: 78434.2 Da    PI: 5.912
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PON92078.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822140.51.6e-43752151134
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr...kgskpleeaeaagssas...aspess 93 
                 gg++r ++ +E+E++k+RER+RRai+a+i+aGLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++   +gs+p   ++a+g+s+s   a ++++
  PON92078.1  75 GGARRCRPVEEKERTKLRERHRRAITARILAGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPsrsQGSRPAGVNSAVGTSSSshmAPQQTP 173
                 6899*****************************************************************988889999966666666555333334444 PP

      DUF822  94 lq.sslkssalaspvesysaspksssfpspssldsislasaa 134
                    ++  +   +  ve  ++++k + +ps+s +d  ++  ++
  PON92078.1 174 PAsLRGAAAGYQGSVEYNASRMKGVYMPSSSPYDISTSGRSQ 215
                 44466667778899999999*************987665443 PP

Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    
MATDMQKLIG TSEEDDEEEM EMDVKEEDDD DEDGRKHAAA VMVGIDGGMP TSSSNNNHQF  60
QQQQQVQEVS TPGGGGARRC RPVEEKERTK LRERHRRAIT ARILAGLRRH GNYNLRVRAD  120
INDVIAALAR EAGWVVLPDG TTFPSRSQGS RPAGVNSAVG TSSSSHMAPQ QTPPASLRGA  180
AAGYQGSVEY NASRMKGVYM PSSSPYDIST SGRSQTSTMV GDRGEQTESH PLIVGSIDTI  240
DDKQIVDISP KLTERDFLST PFIPVYVMLP LGVVNMKCEL VDPDGLLKQL RVLKSVNVDG  300
VAVDCWWGIV EAHAPQEYNW NGYKRLFQMV HELKLKLQVI MSFHECGGNV GDDVCIPLPH  360
WVAEIGRSNP DIFFTDGEGR RNPECLSWGI DKERVLRGRT AVEVYFDFMR SFRIEFNEFF  420
EEGIISMIQV GLGPCGELRY PSCPVKHGWR YPGIGEFQCY DQYLLRSLKK AAEARGHSFW  480
ARGPDNAGSY NSRPHETGFF CDGGDYDGYY GRFFLNWYSK VLVDHGDRVL SLAKLAFEGT  540
YVAAKLSGIH WWYNTASHAA ELTAGFYNSC NRDGYAAIMS MLNKHGAALN FSCAELHMLN  600
HHEDFQDALA DPEGLVWQVL NAAWDVCILV AKENALPCYD RVGYNKILDD AKPSTDPDGR  660
HISSFTYLRL SPHLMERHNF VEFEQFVKKM HGKELNFHLN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0BES1 family protein