PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MCH79328.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; Hologalegina; IRL clade; Trifolieae; Trifolium
Family MIKC_MADS
Protein Properties Length: 156aa    MW: 17480.1 Da    PI: 7.1327
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MCH79328.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.82.8e-1828592051
                HHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF 20 ilKKAeELSvLCdaevaviifsstgklyeyss 51
                +lKKA+ELSvLCdaevavii+s tgklye+ss
  MCH79328.1 28 LLKKAKELSVLCDAEVAVIIYSGTGKLYEFSS 59
                8*****************************96 PP

2K-box37.51e-1388150769
       K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                  s +e  ae  + + a L++ei +L+++  ++ G++L+ L lkeLq Le+qL +++  +++kK
  MCH79328.1  88 PSGDEPPAEVVEPDTALLQEEITKLRSSYLRMSGKELDGLGLKELQYLENQLCEGICAVKNKK 150
                 44566667777888999*********************************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    
MGRGKIEIKK IXXXXXXXXX XXXXXXXLLK KAKELSVLCD AEVAVIIYSG TGKLYEFSSK  60
SMEHTLSRYG TRSLDLNNGA EQQQQQQPSG DEPPAEVVEP DTALLQEEIT KLRSSYLRMS  120
GKELDGLGLK ELQYLENQLC EGICAVKNKK GRPNCM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.11e-20MIKC_MADS family protein