PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7BG052180.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 228aa    MW: 25410.8 Da    PI: 9.9242
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7BG052180.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.6e-1993148156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rrk+ ++tkeq   Le  F+ ++ +s+ +++eLA++l+Lt rqV vWFqNrRa+ k
  TRIDC7BG052180.2  93 RRKKLRLTKEQCALLEGSFRAHNILSHVQKQELARQLNLTSRQVEVWFQNRRARTK 148
                       79999*************************************************98 PP

2HD-ZIP_I/II114.46.8e-3794182189
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       +kk+rl+keq +lLE sF++++ L++ +K+elar+L+l+ rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL++e  eLr+
  TRIDC7BG052180.2  94 RKKLRLTKEQCALLEGSFRAHNILSHVQKQELARQLNLTSRQVEVWFQNRRARTKLKQTEVDCEFLKRWCESLTHENQRLKHELLELRR 182
                       69*************************************************************************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    
MERQDLGAWL GLATGGGAAW HIHDGKRRTG PVQLDALFPQ HGKEERDQDE QKTGGKGARR  60
KIKVGGDDEG RSSSSNGPCL SDGGGSDDAG GGRRKKLRLT KEQCALLEGS FRAHNILSHV  120
QKQELARQLN LTSRQVEVWF QNRRARTKLK QTEVDCEFLK RWCESLTHEN QRLKHELLEL  180
RRSTAASVAA STKLFAQLPR AAAMVNLCPS CEKVSSYLFV CLFLRNNC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19299GRRKKLRL
2143151RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-41HD-ZIP family protein