PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7BG052180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 224aa    MW: 24773.9 Da    PI: 10.172
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7BG052180.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.62.6e-1999154156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rrk+ ++tkeq   Le  F+ ++ +s+ +++eLA++l+Lt rqV vWFqNrRa+ k
  TRIDC7BG052180.1  99 RRKKLRLTKEQCALLEGSFRAHNILSHVQKQELARQLNLTSRQVEVWFQNRRARTK 154
                       79999*************************************************98 PP

2HD-ZIP_I/II114.56.5e-37100188189
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       +kk+rl+keq +lLE sF++++ L++ +K+elar+L+l+ rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL++e  eLr+
  TRIDC7BG052180.1 100 RKKLRLTKEQCALLEGSFRAHNILSHVQKQELARQLNLTSRQVEVWFQNRRARTKLKQTEVDCEFLKRWCESLTHENQRLKHELLELRR 188
                       69*************************************************************************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    
VREPGSMERQ DLGAWLGLAT GGGAAWHIHD GKRRTGPVQL DALFPQHGKE ERDQDEQKTG  60
GKGARRKIKV GGDDEGRSSS SNGPCLSDGG GSDDAGGGRR KKLRLTKEQC ALLEGSFRAH  120
NILSHVQKQE LARQLNLTSR QVEVWFQNRR ARTKLKQTEV DCEFLKRWCE SLTHENQRLK  180
HELLELRRST AASVAASTKL FAQLPRAAAM VNLCPSCEKV AVNN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198105GRRKKLRL
2149157RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-42HD-ZIP family protein