PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7BG034280.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 743aa    MW: 79922.6 Da    PI: 6.1674
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7BG034280.7genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.9e-2084139156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7BG034280.7  84 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 139
                       688999**********************************************9987 PP

2START1862e-582634861206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7BG034280.7 263 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 354
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d          +   +++ Sg+li++++ng+skvtwv
  TRIDC7BG034280.7 355 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDDGLRSA-ARVGGHFRRRASGCLIQEMPNGYSKVTWV 446
                       **********************************************************99988.677777789******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7BG034280.7 447 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 486
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    
NLMDGMHHHQ LPHHHPHQQA ATSESDARGP HGGGNNNSSN NNEELEMSKS GTGSDNNLDG  60
EGGGGGGGEN DEQEDPAGQH PRKKKRYHRH TQHQIQELEA FFKECPHPDD KQRKELSRSL  120
SLEPLQVKFW FQNKRTQIKT QHERQENTAL RTENEKLRAE NMRYKEALAN ASCPNCGGPA  180
AIGEMSFDEH HLRVENARLR DEIDRISAIA AKYVGGKPGS GVAVASASYP PLPPQSSGRS  240
ALDHLGMPGM FGGAEFDKPM VIELAVAAME ELVRMAQLGE PLWVPSLDGE ALGEEEYARA  300
FPRGALGPKS PELRSEASRE TDVVIMNHVS LVEMLMDVRQ WSALFSSIVS RAATLDVLST  360
GVAGNHDGAL QLMSAEFQMP SPLVPTRDTQ FLRYCKQHPG GAWAVVDVSL DDGLRSAARV  420
GGHFRRRASG CLIQEMPNGY SKVTWVEHVE AGDDAMVHDL YRPLVNSGLA FGARRWTSTL  480
KRQCERLASA MATVPSSGGD VITTAEGRRS MLKLAERMTA SFCGGVTAST THQWTTLSGS  540
GAEDVRVMTR KSVDDPGRPP GIILNAATSF WLPVPPSRVF GFLRDDSTRS EWDILSNGGV  600
VQEMAHIANG SHHGNAVSLL RVNNANSNQS NMLILQECCT DATGSYVVYA PVDVVAMNVV  660
LNGGDPDYVA LLPSGFAILP DGPAGAPDAG GSLLTVAFQI LVDSVPTAKL SLGSVATVNS  720
LIACTVDRIK AALVVSPGDN AGT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein