PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7BG034280.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 693aa    MW: 74637.2 Da    PI: 6.0244
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7BG034280.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.2e-203792156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7BG034280.5 37 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 92
                      688999**********************************************9987 PP

2START186.21.8e-582164391206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7BG034280.5 216 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 307
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d          +   +++ Sg+li++++ng+skvtwv
  TRIDC7BG034280.5 308 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDDGLRSA-ARVGGHFRRRASGCLIQEMPNGYSKVTWV 399
                       **********************************************************99988.677777789******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7BG034280.5 400 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 439
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    
NAELDGWDAP PPAPSGGGGG GENDEQEDPA GQHPRKKKRY HRHTQHQIQE LEAFFKECPH  60
PDDKQRKELS RSLSLEPLQV KFWFQNKRTQ IKTQHERQEN TALRTENEKL RAENMRYKEA  120
LANASCPNCG GPAAIGEMSF DEHHLRVENA RLRDEIDRIS AIAAKYVGGK PGSGVAVASA  180
SYPPLPPQSS GRSALDHLGM PGMFGGAEFD KPMVIELAVA AMEELVRMAQ LGEPLWVPSL  240
DGEALGEEEY ARAFPRGALG PKSPELRSEA SRETDVVIMN HVSLVEMLMD VRQWSALFSS  300
IVSRAATLDV LSTGVAGNHD GALQLMSAEF QMPSPLVPTR DTQFLRYCKQ HPGGAWAVVD  360
VSLDDGLRSA ARVGGHFRRR ASGCLIQEMP NGYSKVTWVE HVEAGDDAMV HDLYRPLVNS  420
GLAFGARRWT STLKRQCERL ASAMATVPSS GGDVITTAEG RRSMLKLAER MTASFCGGVT  480
ASTTHQWTTL SGSGAEDVRV MTRKSVDDPG RPPGIILNAA TSFWLPVPPS RVFGFLRDDS  540
TRSEWDILSN GGVVQEMAHI ANGSHHGNAV SLLRVNNANS NQSNMLILQE CCTDATGSYV  600
VYAPVDVVAM NVVLNGGDPD YVALLPSGFA ILPDGPAGAP DAGGSLLTVA FQILVDSVPT  660
AKLSLGSVAT VNSLIACTVD RIKAALVVSP GDN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein