PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7BG034280.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 763aa    MW: 82756.1 Da    PI: 6.5901
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7BG034280.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.2e-20104159156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7BG034280.4 104 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 159
                       688999**********************************************9987 PP

2START185.92.1e-582835061206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7BG034280.4 283 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 374
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d          +   +++ Sg+li++++ng+skvtwv
  TRIDC7BG034280.4 375 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDDGLRSA-ARVGGHFRRRASGCLIQEMPNGYSKVTWV 466
                       **********************************************************99988.677777789******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7BG034280.4 467 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 506
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    
AMQNLMDGMH HHQLPAMLQH QMVDHHLLLP QHHHHPHQQA ATSESDARGP HGGGNNNSSN  60
NNEELEMSKS GTGSDNNLDG EGGGGGGGEN DEQEDPAGQH PRKKKRYHRH TQHQIQELEA  120
FFKECPHPDD KQRKELSRSL SLEPLQVKFW FQNKRTQIKT QHERQENTAL RTENEKLRAE  180
NMRYKEALAN ASCPNCGGPA AIGEMSFDEH HLRVENARLR DEIDRISAIA AKYVGGKPGS  240
GVAVASASYP PLPPQSSGRS ALDHLGMPGM FGGAEFDKPM VIELAVAAME ELVRMAQLGE  300
PLWVPSLDGE ALGEEEYARA FPRGALGPKS PELRSEASRE TDVVIMNHVS LVEMLMDVRQ  360
WSALFSSIVS RAATLDVLST GVAGNHDGAL QLMSAEFQMP SPLVPTRDTQ FLRYCKQHPG  420
GAWAVVDVSL DDGLRSAARV GGHFRRRASG CLIQEMPNGY SKVTWVEHVE AGDDAMVHDL  480
YRPLVNSGLA FGARRWTSTL KRQCERLASA MATVPSSGGD VITTAEGRRS MLKLAERMTA  540
SFCGGVTAST THQWTTLSGS GAEDVRVMTR KSVDDPGRPP GIILNAATSF WLPVPPSRVF  600
GFLRDDSTRS EWDILSNGGV VQEMAHIANG SHHGNAVSLL RVNNANSNQS NMLILQECCT  660
DATGSYVVYA PVDVVAMNVV LNGGDPDYVA LLPSGFAILP DGPAGAPDAG GSLLTVAFQI  720
LVDSVPTAKL SLGSVATVNS LIACTVDRIK AKIKRGQERV RRF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0HD-ZIP family protein