PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7BG034280.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 768aa    MW: 82810 Da    PI: 6.267
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7BG034280.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.2e-20106161156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7BG034280.3 106 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 161
                       688999**********************************************9987 PP

2START185.92.2e-582855081206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7BG034280.3 285 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 376
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d          +   +++ Sg+li++++ng+skvtwv
  TRIDC7BG034280.3 377 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDDGLRSA-ARVGGHFRRRASGCLIQEMPNGYSKVTWV 468
                       **********************************************************99988.677777789******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7BG034280.3 469 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 508
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    
IDAMQNLMDG MHHHQLPAML QHQMVDHHLL LPQHHHHPHQ QAATSESDAR GPHGGGNNNS  60
SNNNEELEMS KSGTGSDNNL DGEGGGGGGG ENDEQEDPAG QHPRKKKRYH RHTQHQIQEL  120
EAFFKECPHP DDKQRKELSR SLSLEPLQVK FWFQNKRTQI KTQHERQENT ALRTENEKLR  180
AENMRYKEAL ANASCPNCGG PAAIGEMSFD EHHLRVENAR LRDEIDRISA IAAKYVGGKP  240
GSGVAVASAS YPPLPPQSSG RSALDHLGMP GMFGGAEFDK PMVIELAVAA MEELVRMAQL  300
GEPLWVPSLD GEALGEEEYA RAFPRGALGP KSPELRSEAS RETDVVIMNH VSLVEMLMDV  360
RQWSALFSSI VSRAATLDVL STGVAGNHDG ALQLMSAEFQ MPSPLVPTRD TQFLRYCKQH  420
PGGAWAVVDV SLDDGLRSAA RVGGHFRRRA SGCLIQEMPN GYSKVTWVEH VEAGDDAMVH  480
DLYRPLVNSG LAFGARRWTS TLKRQCERLA SAMATVPSSG GDVITTAEGR RSMLKLAERM  540
TASFCGGVTA STTHQWTTLS GSGAEDVRVM TRKSVDDPGR PPGIILNAAT SFWLPVPPSR  600
VFGFLRDDST RSEWDILSNG GVVQEMAHIA NGSHHGNAVS LLRVNNANSN QSNMLILQEC  660
CTDATGSYVV YAPVDVVAMN VVLNGGDPDY VALLPSGFAI LPDGPAGAPD AGGSLLTVAF  720
QILVDSVPTA KLSLGSVATV NSLIACTVDR IKAALVVSPG DNAGTAAR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0HD-ZIP family protein