PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7BG034280.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 769aa    MW: 82998.2 Da    PI: 6.3765
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7BG034280.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.3e-20107162156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7BG034280.2 107 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 162
                       688999**********************************************9987 PP

2START185.92.2e-582865091206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7BG034280.2 286 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 377
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d          +   +++ Sg+li++++ng+skvtwv
  TRIDC7BG034280.2 378 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDDGLRSA-ARVGGHFRRRASGCLIQEMPNGYSKVTWV 469
                       **********************************************************99988.677777789******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7BG034280.2 470 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 509
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 769 aa     Download sequence    
VRFKSENLMD GMHHHQLPAM LQHQMVDHHL LLPQHHHHPH QQAATSESDA RGPHGGGNNN  60
SSNNNEELEM SKSGTGSDNN LDGEGGGGGG GENDEQEDPA GQHPRKKKRY HRHTQHQIQE  120
LEAFFKECPH PDDKQRKELS RSLSLEPLQV KFWFQNKRTQ IKTQHERQEN TALRTENEKL  180
RAENMRYKEA LANASCPNCG GPAAIGEMSF DEHHLRVENA RLRDEIDRIS AIAAKYVGGK  240
PGSGVAVASA SYPPLPPQSS GRSALDHLGM PGMFGGAEFD KPMVIELAVA AMEELVRMAQ  300
LGEPLWVPSL DGEALGEEEY ARAFPRGALG PKSPELRSEA SRETDVVIMN HVSLVEMLMD  360
VRQWSALFSS IVSRAATLDV LSTGVAGNHD GALQLMSAEF QMPSPLVPTR DTQFLRYCKQ  420
HPGGAWAVVD VSLDDGLRSA ARVGGHFRRR ASGCLIQEMP NGYSKVTWVE HVEAGDDAMV  480
HDLYRPLVNS GLAFGARRWT STLKRQCERL ASAMATVPSS GGDVITTAEG RRSMLKLAER  540
MTASFCGGVT ASTTHQWTTL SGSGAEDVRV MTRKSVDDPG RPPGIILNAA TSFWLPVPPS  600
RVFGFLRDDS TRSEWDILSN GGVVQEMAHI ANGSHHGNAV SLLRVNNANS NQSNMLILQE  660
CCTDATGSYV VYAPVDVVAM NVVLNGGDPD YVALLPSGFA ILPDGPAGAP DAGGSLLTVA  720
FQILVDSVPT AKLSLGSVAT VNSLIACTVD RIKAALVVSP GDNAGTAAR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein