PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7BG034280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 798aa    MW: 85647.3 Da    PI: 6.4297
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7BG034280.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.7e-20136191156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7BG034280.1 136 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 191
                       688999**********************************************9987 PP

2START185.82.3e-583155381206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7BG034280.1 315 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 406
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d          +   +++ Sg+li++++ng+skvtwv
  TRIDC7BG034280.1 407 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDDGLRSA-ARVGGHFRRRASGCLIQEMPNGYSKVTWV 498
                       **********************************************************99988.677777789******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7BG034280.1 499 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 538
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 798 aa     Download sequence    
MPGGMMIPGR NMIGRSNGAG VAYASSSSSA LSLGQNLMDG MHHHQLPAML QHQMVDHHLL  60
LPQHHHHPHQ QAATSESDAR GPHGGGNNNS SNNNEELEMS KSGTGSDNNL DGEGGGGGGG  120
ENDEQEDPAG QHPRKKKRYH RHTQHQIQEL EAFFKECPHP DDKQRKELSR SLSLEPLQVK  180
FWFQNKRTQI KTQHERQENT ALRTENEKLR AENMRYKEAL ANASCPNCGG PAAIGEMSFD  240
EHHLRVENAR LRDEIDRISA IAAKYVGGKP GSGVAVASAS YPPLPPQSSG RSALDHLGMP  300
GMFGGAEFDK PMVIELAVAA MEELVRMAQL GEPLWVPSLD GEALGEEEYA RAFPRGALGP  360
KSPELRSEAS RETDVVIMNH VSLVEMLMDV RQWSALFSSI VSRAATLDVL STGVAGNHDG  420
ALQLMSAEFQ MPSPLVPTRD TQFLRYCKQH PGGAWAVVDV SLDDGLRSAA RVGGHFRRRA  480
SGCLIQEMPN GYSKVTWVEH VEAGDDAMVH DLYRPLVNSG LAFGARRWTS TLKRQCERLA  540
SAMATVPSSG GDVITTAEGR RSMLKLAERM TASFCGGVTA STTHQWTTLS GSGAEDVRVM  600
TRKSVDDPGR PPGIILNAAT SFWLPVPPSR VFGFLRDDST RSEWDILSNG GVVQEMAHIA  660
NGSHHGNAVS LLRVNNANSN QSNMLILQEC CTDATGSYVV YAPVDVVAMN VVLNGGDPDY  720
VALLPSGFAI LPDGPAGAPD AGGSLLTVAF QILVDSVPTA KLSLGSVATV NSLIACTVDR  780
IKAALVVSPG DNAGTAAR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0HD-ZIP family protein