PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7BG010900.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 683aa    MW: 74763.1 Da    PI: 6.9853
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7BG010900.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.2e-211570156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      r++ +++t+ q+++Le++F+++++p++++r+ L+++lgL+ rq+k+WFqNrR+++k
  TRIDC7BG010900.3 15 RKRYHRHTPRQIQTLEAMFKECPHPDEAQRANLSRELGLEARQIKFWFQNRRTQMK 70
                      789999***********************************************998 PP

2START118.21.1e-372124553206
                       HHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
             START   3 aeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                       a +a++el+++ + +e++Wvk +        + + +d  ++k+ +s+      ++e +r+s++v m+++ lve ++d + ++ e ++     a
  TRIDC7BG010900.3 212 ATRAMDELIRLTQQGENVWVKIPggdgreiiDVQAYDSIYSKPGSSNLragdIRVEGSRDSAIVCMNPVCLVEVFMDPS-KFMEFFPsivsHA 303
                       6789**********************999999999999999997777799999****************9999999999.9999999555455 PP

                       EEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE..... CS
             START  80 etlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh..... 161
                        +++ + +g     + l+ m+ +l + +p+vp R+f f+Ry+rq  +g w+i+dvS d ++++    +  R+++lpSg+li ++ ng+     
  TRIDC7BG010900.3 304 RITDPLVNGlngrsESLVMMYEQLHFTTPAVPtREFSFLRYCRQIDQGMWAIADVSADMQREVHYGGPPSRSRRLPSGCLISEMTNGYsrvse 396
                       555556666******************************************************9888889*********************** PP

                       .............EEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 162 .............skvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                                      vtwveh++ ++++p   l+r +v+sg+a+ga +wva+l+r ce+
  TRIDC7BG010900.3 397 qrtndtsvhrplaLVVTWVEHMEIEDKSPiGPLYRDIVQSGAAFGAHRWVAALHRACER 455
                       **********999899*****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    
SNHHQQQQQN QNQRRKRYHR HTPRQIQTLE AMFKECPHPD EAQRANLSRE LGLEARQIKF  60
WFQNRRTQMK AQHERQDNCF LRQENDKIRC ENIAMREALK NVICPTCGGP PIAEDYFDEQ  120
KLRMENARLK QELDQVAGLT AKYLGRPFTQ LPQGTPQMNV SSLDLSMGGV GGLSLDLDLS  180
GAGLGMPLSD MPTMHLPAPV TEKERPLLAK MATRAMDELI RLTQQGENVW VKIPGGDGRE  240
IIDVQAYDSI YSKPGSSNLR AGDIRVEGSR DSAIVCMNPV CLVEVFMDPS KFMEFFPSIV  300
SHARITDPLV NGLNGRSESL VMMYEQLHFT TPAVPTREFS FLRYCRQIDQ GMWAIADVSA  360
DMQREVHYGG PPSRSRRLPS GCLISEMTNG YSRVSEQRTN DTSVHRPLAL VVTWVEHMEI  420
EDKSPIGPLY RDIVQSGAAF GAHRWVAALH RACERYASSV EVPGVMHGET TGVTAEGRRS  480
MMALSQRMVS SFCGGMTASP QHQWTTMPGA GGSEVCVRVS MNQGSQPGQP NGVVLGAATS  540
VWLPVPADHV FGFLRDENTR TQSPQGGQAT ILVLQESCTD TSGCSMVVHS PIDIPAANMM  600
MSGADPSGIP LLPSGFAIWP AGVGGGASTS AATPMAAGCI VSVAFQILIS SLPSSKLNAE  660
SIATVNNLVS TTVQNIKTAL NCA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.10.0HD-ZIP family protein