PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG059260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 219aa    MW: 24363.4 Da    PI: 9.8094
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG059260.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.8e-1994149156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rrk+ ++tkeq   Le  F+ ++ +s+ +++eLA++l+L+ rqV vWFqNrRa+ k
  TRIDC7AG059260.1  94 RRKKLRLTKEQCALLEGSFRAHNILSHVQKQELARQLNLSSRQVEVWFQNRRARTK 149
                       79999*************************************************98 PP

2HD-ZIP_I/II113.31.5e-3695183189
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       +kk+rl+keq +lLE sF++++ L++ +K+elar+L+l+ rqv+vWFqnrRARtk+kq+E+d+e+L+r++++l++en+rL++e  eL++
  TRIDC7AG059260.1  95 RKKLRLTKEQCALLEGSFRAHNILSHVQKQELARQLNLSSRQVEVWFQNRRARTKLKQTEVDCEFLRRWCESLTHENQRLKHELLELQR 183
                       69***********************************************************************************9985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    
MERQDLGAWL GLATGGGAVW HTHDGERRPN HPVRLDELFP QHGKEERDQD EQKTGGKGAR  60
RKMKVADDEG RSSSSNGPCL SDGGGSDGGG GGGRRKKLRL TKEQCALLEG SFRAHNILSH  120
VQKQELARQL NLSSRQVEVW FQNRRARTKL KQTEVDCEFL RRWCESLTHE NQRLKHELLE  180
LQRSAAPPVA AGSKLFAQLP RAAAIMNLCP SCEKVAVNN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
193100GRRKKLRL
2144152RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-42HD-ZIP family protein