PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG043000.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 763aa    MW: 82479.7 Da    PI: 6.3762
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG043000.7genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.2e-20101156156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7AG043000.7 101 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 156
                       688999**********************************************9987 PP

2START186.51.4e-582805021206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7AG043000.7 280 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 371
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d  ++      +   +++ Sg+li++++ng+skvtwv
  TRIDC7AG043000.7 372 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDGLRSAAR--VGGHFRRRASGCLIQEMPNGYSKVTWV 462
                       ***********************************************************99876..3444447******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7AG043000.7 463 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 502
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    
MQNLMDGMHH HQLPAMLQHQ MVDHHLLLPQ HHHHPHQQAA TSESDARGPH GRGNNNSSNN  60
NEELEMSKSG TGSDNNLDGG EGGGGEDDEQ EDPAGQHPRK KKRYHRHTQH QIQELEAFFK  120
ECPHPDDKQR KELSRSLSLE PLQVKFWFQN KRTQIKTQHE RQENTALRTE NEKLRAENMR  180
YKEALANASC PNCGGPAAIG EMSFDEHHLR VENARLRDEI DRISAIAAKY VGGKPGAGVA  240
VASAAYPPLP PQSSGRSALD HLGMPSMFGG AEFDKPMVIE LAVAAMEELV RMAQLGEPLW  300
VPSLDGEALG EEEYARAFPR GALGPKSPEL RSEASRETDV VIMNHVSLVE MLMDVRQWSA  360
LFSSIVSRAA TLDVLSTGVA GNHDGALQLM SAEFQMPSPL VPTRDTQFLR YCKQHPGGAW  420
AVVDVSLDGL RSAARVGGHF RRRASGCLIQ EMPNGYSKVT WVEHVEAGDD AMVHDLYRPL  480
VNSGLAFGAR RWTSTLKRQC ERLASAMATV PSSGGDVITT AEGRRSMLKL AERMTASFCG  540
GVTASTTHQW TTLSGSGAED VRVMTRKSVD DPGRPPGIIL NAATSFWLPV PPSRVFGFLR  600
DDSTRSEWDI LSNGGVVQEM AHIANGSHHG NAVSLLRVNN ANSNQSNMLI LQECCTDATG  660
SYVVYAPVDV VAMNVVLNGG DPDYVALLPS GFAILPDGPA GAPDAGGSLL TVAFQILVDS  720
VPTAKLSLGS VATVNSLIAC TVDRIKAAVV VSPGDNAGAA TNR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein