PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG043000.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 742aa    MW: 80006.9 Da    PI: 6.2328
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG043000.6genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.9e-2084139156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7AG043000.6  84 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 139
                       688999**********************************************9987 PP

2START186.61.3e-582634851206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7AG043000.6 263 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 354
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d  ++      +   +++ Sg+li++++ng+skvtwv
  TRIDC7AG043000.6 355 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDGLRSAAR--VGGHFRRRASGCLIQEMPNGYSKVTWV 445
                       ***********************************************************99876..3444447******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7AG043000.6 446 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 485
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    
MQNLMDGMHH HQLPHHHPHQ QAATSESDAR GPHGRGNNNS SNNNEELEMS KSGTGSDNNL  60
DGGEGGGGED DEQEDPAGQH PRKKKRYHRH TQHQIQELEA FFKECPHPDD KQRKELSRSL  120
SLEPLQVKFW FQNKRTQIKT QHERQENTAL RTENEKLRAE NMRYKEALAN ASCPNCGGPA  180
AIGEMSFDEH HLRVENARLR DEIDRISAIA AKYVGGKPGA GVAVASAAYP PLPPQSSGRS  240
ALDHLGMPSM FGGAEFDKPM VIELAVAAME ELVRMAQLGE PLWVPSLDGE ALGEEEYARA  300
FPRGALGPKS PELRSEASRE TDVVIMNHVS LVEMLMDVRQ WSALFSSIVS RAATLDVLST  360
GVAGNHDGAL QLMSAEFQMP SPLVPTRDTQ FLRYCKQHPG GAWAVVDVSL DGLRSAARVG  420
GHFRRRASGC LIQEMPNGYS KVTWVEHVEA GDDAMVHDLY RPLVNSGLAF GARRWTSTLK  480
RQCERLASAM ATVPSSGGDV ITTAEGRRSM LKLAERMTAS FCGGVTASTT HQWTTLSGSG  540
AEDVRVMTRK SVDDPGRPPG IILNAATSFW LPVPPSRVFG FLRDDSTRSE WDILSNGGVV  600
QEMAHIANGS HHGNAVSLLR VNNANSNQSN MLILQECCTD ATGSYVVYAP VDVVAMNVVL  660
NGGDPDYVAL LPSGFAILPD GPAGAPDAGG SLLTVAFQIL VDSVPTAKLS LGSVATVNSL  720
IACTVDRIKA AVVVSPGDNA GA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein