PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG043000.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 729aa    MW: 78688.9 Da    PI: 6.4687
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG043000.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.7e-2074129156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7AG043000.5  74 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 129
                       688999**********************************************9987 PP

2START186.61.3e-582534751206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7AG043000.5 253 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 344
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d  ++      +   +++ Sg+li++++ng+skvtwv
  TRIDC7AG043000.5 345 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDGLRSAAR--VGGHFRRRASGCLIQEMPNGYSKVTWV 435
                       ***********************************************************99876..3444447******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7AG043000.5 436 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 475
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 729 aa     Download sequence    
MGCTTTSSQQ CCSTRWLITI FFFPSTTTTP TSRRPRARAM PSGTGSDNNL DGGEGGGGED  60
DEQEDPAGQH PRKKKRYHRH TQHQIQELEA FFKECPHPDD KQRKELSRSL SLEPLQVKFW  120
FQNKRTQIKT QHERQENTAL RTENEKLRAE NMRYKEALAN ASCPNCGGPA AIGEMSFDEH  180
HLRVENARLR DEIDRISAIA AKYVGGKPGA GVAVASAAYP PLPPQSSGRS ALDHLGMPSM  240
FGGAEFDKPM VIELAVAAME ELVRMAQLGE PLWVPSLDGE ALGEEEYARA FPRGALGPKS  300
PELRSEASRE TDVVIMNHVS LVEMLMDVRQ WSALFSSIVS RAATLDVLST GVAGNHDGAL  360
QLMSAEFQMP SPLVPTRDTQ FLRYCKQHPG GAWAVVDVSL DGLRSAARVG GHFRRRASGC  420
LIQEMPNGYS KVTWVEHVEA GDDAMVHDLY RPLVNSGLAF GARRWTSTLK RQCERLASAM  480
ATVPSSGGDV ITTAEGRRSM LKLAERMTAS FCGGVTASTT HQWTTLSGSG AEDVRVMTRK  540
SVDDPGRPPG IILNAATSFW LPVPPSRVFG FLRDDSTRSE WDILSNGGVV QEMAHIANGS  600
HHGNAVSLLR VNNANSNQSN MLILQECCTD ATGSYVVYAP VDVVAMNVVL NGGDPDYVAL  660
LPSGFAILPD GPAGAPDAGG SLLTVAFQIL VDSVPTAKLS LGSVATVNSL IACTVDRIKA  720
AVVVSPGDN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein