PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG043000.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 714aa    MW: 76809.4 Da    PI: 5.8221
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG043000.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.5e-2058113156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7AG043000.4  58 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 113
                       688999**********************************************9987 PP

2START186.71.2e-582374591206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7AG043000.4 237 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 328
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d  ++      +   +++ Sg+li++++ng+skvtwv
  TRIDC7AG043000.4 329 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDGLRSAAR--VGGHFRRRASGCLIQEMPNGYSKVTWV 419
                       ***********************************************************99876..3444447******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7AG043000.4 420 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 459
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    
MGCTTTSSQG NNNSSNNNEE LEMSKSGTGS DNNLDGGEGG GGEDDEQEDP AGQHPRKKKR  60
YHRHTQHQIQ ELEAFFKECP HPDDKQRKEL SRSLSLEPLQ VKFWFQNKRT QIKTQHERQE  120
NTALRTENEK LRAENMRYKE ALANASCPNC GGPAAIGEMS FDEHHLRVEN ARLRDEIDRI  180
SAIAAKYVGG KPGAGVAVAS AAYPPLPPQS SGRSALDHLG MPSMFGGAEF DKPMVIELAV  240
AAMEELVRMA QLGEPLWVPS LDGEALGEEE YARAFPRGAL GPKSPELRSE ASRETDVVIM  300
NHVSLVEMLM DVRQWSALFS SIVSRAATLD VLSTGVAGNH DGALQLMSAE FQMPSPLVPT  360
RDTQFLRYCK QHPGGAWAVV DVSLDGLRSA ARVGGHFRRR ASGCLIQEMP NGYSKVTWVE  420
HVEAGDDAMV HDLYRPLVNS GLAFGARRWT STLKRQCERL ASAMATVPSS GGDVITTAEG  480
RRSMLKLAER MTASFCGGVT ASTTHQWTTL SGSGAEDVRV MTRKSVDDPG RPPGIILNAA  540
TSFWLPVPPS RVFGFLRDDS TRSEWDILSN GGVVQEMAHI ANGSHHGNAV SLLRVNNANS  600
NQSNMLILQE CCTDATGSYV VYAPVDVVAM NVVLNGGDPD YVALLPSGFA ILPDGPAGAP  660
DAGGSLLTVA FQILVDSVPT AKLSLGSVAT VNSLIACTVD RIKAAVVVSP GDNA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein