PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG043000.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 703aa    MW: 75669.3 Da    PI: 5.7117
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG043000.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.4e-2048103156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7AG043000.3  48 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 103
                       688999**********************************************9987 PP

2START186.71.2e-582274491206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7AG043000.3 227 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 318
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d  ++      +   +++ Sg+li++++ng+skvtwv
  TRIDC7AG043000.3 319 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDGLRSAAR--VGGHFRRRASGCLIQEMPNGYSKVTWV 409
                       ***********************************************************99876..3444447******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7AG043000.3 410 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 449
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    
LCNAELDGWD APPPAPSTGS DNNLDGGEGG GGEDDEQEDP AGQHPRKKKR YHRHTQHQIQ  60
ELEAFFKECP HPDDKQRKEL SRSLSLEPLQ VKFWFQNKRT QIKTQHERQE NTALRTENEK  120
LRAENMRYKE ALANASCPNC GGPAAIGEMS FDEHHLRVEN ARLRDEIDRI SAIAAKYVGG  180
KPGAGVAVAS AAYPPLPPQS SGRSALDHLG MPSMFGGAEF DKPMVIELAV AAMEELVRMA  240
QLGEPLWVPS LDGEALGEEE YARAFPRGAL GPKSPELRSE ASRETDVVIM NHVSLVEMLM  300
DVRQWSALFS SIVSRAATLD VLSTGVAGNH DGALQLMSAE FQMPSPLVPT RDTQFLRYCK  360
QHPGGAWAVV DVSLDGLRSA ARVGGHFRRR ASGCLIQEMP NGYSKVTWVE HVEAGDDAMV  420
HDLYRPLVNS GLAFGARRWT STLKRQCERL ASAMATVPSS GGDVITTAEG RRSMLKLAER  480
MTASFCGGVT ASTTHQWTTL SGSGAEDVRV MTRKSVDDPG RPPGIILNAA TSFWLPVPPS  540
RVFGFLRDDS TRSEWDILSN GGVVQEMAHI ANGSHHGNAV SLLRVNNANS NQSNMLILQE  600
CCTDATGSYV VYAPVDVVAM NVVLNGGDPD YVALLPSGFA ILPDGPAGAP DAGGSLLTVA  660
FQILVDSVPT AKLSLGSVAT VNSLIACTVD RIKAAVVVSP GDN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein