PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG043000.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 779aa    MW: 84235.7 Da    PI: 6.3217
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG043000.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.4e-20120175156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R++ k
  TRIDC7AG043000.2 120 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRSLSLEPLQVKFWFQNKRTQIK 175
                       688999**********************************************9987 PP

2START186.41.5e-582995211206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       ela +a++elv++a+++ep+Wv s   e + ++e+ + f+++         ++ea+r++ vv+m+++ lve l+d++ qW+  +     +a+t
  TRIDC7AG043000.2 299 ELAVAAMEELVRMAQLGEPLWVPSLdgEALGEEEYARAFPRGALgpkspeLRSEASRETDVVIMNHVSLVEMLMDVR-QWSALFSsivsRAAT 390
                       57899********************999999********99877*********************************.99999999999**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+v+s+g      galqlm+ae+q++splvp Rd  f+Ry++q+++g w++vdvS+d  ++      +   +++ Sg+li++++ng+skvtwv
  TRIDC7AG043000.2 391 LDVLSTGvagnhdGALQLMSAEFQMPSPLVPtRDTQFLRYCKQHPGGAWAVVDVSLDGLRSAAR--VGGHFRRRASGCLIQEMPNGYSKVTWV 481
                       ***********************************************************99876..3444447******************** PP

                       E-EE--S.SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkg.rlphwllrslvksglaegaktwvatlqrqcek 206
                       ehv+ ++ +++h l+r+lv+sgla+ga++w++tl+rqce+
  TRIDC7AG043000.2 482 EHVEAGDdAMVHDLYRPLVNSGLAFGARRWTSTLKRQCER 521
                       ****9752678***************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 779 aa     Download sequence    
FLNFLISCTL QIRSDSQAFN SNLMDGMHHH QLPAMLQHQM VDHHLLLPQH HHHPHQQAAT  60
SESDARGPHG RGNNNSSNNN EELEMSKSGT GSDNNLDGGE GGGGEDDEQE DPAGQHPRKK  120
KRYHRHTQHQ IQELEAFFKE CPHPDDKQRK ELSRSLSLEP LQVKFWFQNK RTQIKTQHER  180
QENTALRTEN EKLRAENMRY KEALANASCP NCGGPAAIGE MSFDEHHLRV ENARLRDEID  240
RISAIAAKYV GGKPGAGVAV ASAAYPPLPP QSSGRSALDH LGMPSMFGGA EFDKPMVIEL  300
AVAAMEELVR MAQLGEPLWV PSLDGEALGE EEYARAFPRG ALGPKSPELR SEASRETDVV  360
IMNHVSLVEM LMDVRQWSAL FSSIVSRAAT LDVLSTGVAG NHDGALQLMS AEFQMPSPLV  420
PTRDTQFLRY CKQHPGGAWA VVDVSLDGLR SAARVGGHFR RRASGCLIQE MPNGYSKVTW  480
VEHVEAGDDA MVHDLYRPLV NSGLAFGARR WTSTLKRQCE RLASAMATVP SSGGDVITTA  540
EGRRSMLKLA ERMTASFCGG VTASTTHQWT TLSGSGAEDV RVMTRKSVDD PGRPPGIILN  600
AATSFWLPVP PSRVFGFLRD DSTRSEWDIL SNGGVVQEMA HIANGSHHGN AVSLLRVNNA  660
NSNQSNMLIL QECCTDATGS YVVYAPVDVV AMNVVLNGGD PDYVALLPSG FAILPDGPAG  720
APDAGGSLLT VAFQILVDSV PTAKLSLGSV ATVNSLIACT VDRIKAAVVV SPGDNAGAA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein