PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG020820.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 612aa    MW: 68227.4 Da    PI: 6.9668
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG020820.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.57.1e-212782156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      r++ +++t+ q+++Le++F+++++p++++r+ L+++lgL+ rq+k+WFqNrR+++k
  TRIDC7AG020820.5 27 RKRYHRHTPRQIQTLEAMFKECPHPDEAQRANLSRELGLEARQIKFWFQNRRTQMK 82
                      789999***********************************************998 PP

2START142.25.1e-452414663206
                       HHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
             START   3 aeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                       a +a++el+++ + + ++Wvk +        + +++d  ++k+ +s++     ++e +r+s++v m +++lve ++d + ++ e ++     a
  TRIDC7AG020820.5 241 ATRAMDELIRLTQQGGNVWVKIPggdgretiDVQEYDSIYSKPGSSNFragdIRVEGSRDSAIVCMSPVNLVEVFMDPS-KFMEFFPsivsHA 332
                       6789************************9999999999*****99999999999*************************.9999999555555 PP

                       EEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
             START  80 etlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                        +++ + +g     + l+ m+ +lq+++p+vp R+f f+Ry+rq  +g w+i+dvS d +++    ++  R+++lpSg+li ++ ng+skvtw
  TRIDC7AG020820.5 333 RITDPLVNGlnrrnESLVMMYEQLQFMTPAVPtREFSFLRYCRQIDQGMWAIADVSADMQREAHYGAPPPRSRRLPSGCLIADMTNGYSKVTW 425
                       555556666****************************************************9988999************************* PP

                       EE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 167 vehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                       veh++ ++++p   l+r +v+sg+a+ga +wva+l+r ce+
  TRIDC7AG020820.5 426 VEHMEIEDKSPiGPLYRDIVQSGAAFGAHRWVAALHRACER 466
                       ***************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    
MDFGDDQEGG SESNQHQQQQ QNQNQRRKRY HRHTPRQIQT LEAMFKECPH PDEAQRANLS  60
RELGLEARQI KFWFQNRRTQ MKAQHERQDN CFLRQENDKI RCENIAMREA LKNVICPTCG  120
GPPIAEDYFD EQKLRMENAR LKQELDSVAG LTAKYLGRPF TQLPQGTPQM NVSSLDLSMG  180
GVPMGGVPMG GGHHQPFGGG LSLDLDLLSG AGLGMPLSDM PTMHLPAPVT EKERPDMAKM  240
ATRAMDELIR LTQQGGNVWV KIPGGDGRET IDVQEYDSIY SKPGSSNFRA GDIRVEGSRD  300
SAIVCMSPVN LVEVFMDPSK FMEFFPSIVS HARITDPLVN GLNRRNESLV MMYEQLQFMT  360
PAVPTREFSF LRYCRQIDQG MWAIADVSAD MQREAHYGAP PPRSRRLPSG CLIADMTNGY  420
SKVTWVEHME IEDKSPIGPL YRDIVQSGAA FGAHRWVAAL HRACERYASS LEVPGVMHGE  480
TTGVTAEGRR SMMALSQRMV SSFCGGMTAS PQHQWTTMPG AAGNEVCVRV SMNQGAQPGH  540
PNGVVLGAAT SVWLPVPADH VFGFLRDENT RTQWDVLCKE NSVQPVSRIP NGPNPGNCIT  600
LLRVMTNDLT RR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.11e-176HD-ZIP family protein