PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG020820.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 714aa    MW: 78038.9 Da    PI: 6.9539
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG020820.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.6e-211772156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      r++ +++t+ q+++Le++F+++++p++++r+ L+++lgL+ rq+k+WFqNrR+++k
  TRIDC7AG020820.4 17 RKRYHRHTPRQIQTLEAMFKECPHPDEAQRANLSRELGLEARQIKFWFQNRRTQMK 72
                      789999***********************************************998 PP

2START141.77e-452314563206
                       HHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
             START   3 aeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                       a +a++el+++ + + ++Wvk +        + +++d  ++k+ +s++     ++e +r+s++v m +++lve ++d + ++ e ++     a
  TRIDC7AG020820.4 231 ATRAMDELIRLTQQGGNVWVKIPggdgretiDVQEYDSIYSKPGSSNFragdIRVEGSRDSAIVCMSPVNLVEVFMDPS-KFMEFFPsivsHA 322
                       6789************************9999999999*****99999999999*************************.9999999555555 PP

                       EEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
             START  80 etlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                        +++ + +g     + l+ m+ +lq+++p+vp R+f f+Ry+rq  +g w+i+dvS d +++    ++  R+++lpSg+li ++ ng+skvtw
  TRIDC7AG020820.4 323 RITDPLVNGlnrrnESLVMMYEQLQFMTPAVPtREFSFLRYCRQIDQGMWAIADVSADMQREAHYGAPPPRSRRLPSGCLIADMTNGYSKVTW 415
                       555556666****************************************************9988999************************* PP

                       EE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 167 vehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                       veh++ ++++p   l+r +v+sg+a+ga +wva+l+r ce+
  TRIDC7AG020820.4 416 VEHMEIEDKSPiGPLYRDIVQSGAAFGAHRWVAALHRACER 456
                       ***************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    
SESNQHQQQQ QNQNQRRKRY HRHTPRQIQT LEAMFKECPH PDEAQRANLS RELGLEARQI  60
KFWFQNRRTQ MKAQHERQDN CFLRQENDKI RCENIAMREA LKNVICPTCG GPPIAEDYFD  120
EQKLRMENAR LKQELDSVAG LTAKYLGRPF TQLPQGTPQM NVSSLDLSMG GVPMGGVPMG  180
GGHHQPFGGG LSLDLDLLSG AGLGMPLSDM PTMHLPAPVT EKERPDMAKM ATRAMDELIR  240
LTQQGGNVWV KIPGGDGRET IDVQEYDSIY SKPGSSNFRA GDIRVEGSRD SAIVCMSPVN  300
LVEVFMDPSK FMEFFPSIVS HARITDPLVN GLNRRNESLV MMYEQLQFMT PAVPTREFSF  360
LRYCRQIDQG MWAIADVSAD MQREAHYGAP PPRSRRLPSG CLIADMTNGY SKVTWVEHME  420
IEDKSPIGPL YRDIVQSGAA FGAHRWVAAL HRACERYASS LEVPGVMHGE TTGVTAEGRR  480
SMMALSQRMV SSFCGGMTAS PQHQWTTMPG AAGNEVCVRV SMNQGAQPGH PNGVVLGAAT  540
SVWLPVPADH VFGFLRDENT RTQWDVLCKE NSVQPVSRIP NGPNPGNCIT LLRTPQGGQA  600
TILVLQESCT DASGCSMVVY SPIDIPAANM MMSGADPSGI PLLPSGFAIW PAGVGGGAST  660
SAATPMAAGC IVSVAFQILI SSLPSSKLNA ESIATVNNLV STTVQNIKAA LNCV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.10.0HD-ZIP family protein