PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG020820.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 683aa    MW: 74996.3 Da    PI: 7.0489
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG020820.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.2e-211671156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      r++ +++t+ q+++Le++F+++++p++++r+ L+++lgL+ rq+k+WFqNrR+++k
  TRIDC7AG020820.3 16 RKRYHRHTPRQIQTLEAMFKECPHPDEAQRANLSRELGLEARQIKFWFQNRRTQMK 71
                      789999***********************************************998 PP

2START132.45.1e-422134553206
                       HHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
             START   3 aeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                       a +a++el+++ + + ++Wvk +        + +++d  ++k+ +s++     ++e +r+s++v m +++lve ++d + ++ e ++     a
  TRIDC7AG020820.3 213 ATRAMDELIRLTQQGGNVWVKIPggdgretiDVQEYDSIYSKPGSSNFragdIRVEGSRDSAIVCMSPVNLVEVFMDPS-KFMEFFPsivsHA 304
                       6789************************9999999999*****99999999999*************************.9999999555555 PP

                       EEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE..... CS
             START  80 etlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh..... 161
                        +++ + +g     + l+ m+ +lq+++p+vp R+f f+Ry+rq  +g w+i+dvS d +++    ++  R+++lpSg+li ++ ng+     
  TRIDC7AG020820.3 305 RITDPLVNGlnrrnESLVMMYEQLQFMTPAVPtREFSFLRYCRQIDQGMWAIADVSADMQREAHYGAPPPRSRRLPSGCLIADMTNGYskvsq 397
                       555556666****************************************************9988999************************* PP

                       ............EEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 162 ............skvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                                   s+vtwveh++ ++++p   l+r +v+sg+a+ga +wva+l+r ce+
  TRIDC7AG020820.3 398 qrandrsvhrplSCVTWVEHMEIEDKSPiGPLYRDIVQSGAAFGAHRWVAALHRACER 455
                       ********************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    
ESNQHQQQQQ NQNQRRKRYH RHTPRQIQTL EAMFKECPHP DEAQRANLSR ELGLEARQIK  60
FWFQNRRTQM KAQHERQDNC FLRQENDKIR CENIAMREAL KNVICPTCGG PPIAEDYFDE  120
QKLRMENARL KQELDSVAGL TAKYLGRPFT QLPQGTPQMN VSSLDLSPFG GGLSLDLDLL  180
SGAGLGMPLS DMPTMHLPAP VTEKERPDMA KMATRAMDEL IRLTQQGGNV WVKIPGGDGR  240
ETIDVQEYDS IYSKPGSSNF RAGDIRVEGS RDSAIVCMSP VNLVEVFMDP SKFMEFFPSI  300
VSHARITDPL VNGLNRRNES LVMMYEQLQF MTPAVPTREF SFLRYCRQID QGMWAIADVS  360
ADMQREAHYG APPPRSRRLP SGCLIADMTN GYSKVSQQRA NDRSVHRPLS CVTWVEHMEI  420
EDKSPIGPLY RDIVQSGAAF GAHRWVAALH RACERYASSL EVPGVMHGET TGVTAEGRRS  480
MMALSQRMVS SFCGGMTASP QHQWTTMPGA AGNEVCVRVS MNQGAQPGHP NGVVLGAATS  540
VWLPVPADHV FGFLRDENTR TQTPQGGQAT ILVLQESCTD ASGCSMVVYS PIDIPAANMM  600
MSGADPSGIP LLPSGFAIWP AGVGGGASTS AATPMAAGCI VSVAFQILIS SLPSSKLNAE  660
SIATVNNLVS TTVQNIKAAL NCV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.10.0HD-ZIP family protein