PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG009460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 307aa    MW: 32651.3 Da    PI: 9.9699
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG009460.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-19121175256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Lee+F+ +++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC7AG009460.1 121 RKKLRLSKDQAAVLEECFKTHSTLNPKQKTALANRLGLRPRQVEVWFQNRRARTK 175
                       678899***********************************************98 PP

2HD-ZIP_I/II123.87.9e-40121211192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       +kk+rlsk+q+++LEe+F+++++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e++kr++++l+e+n+rLekev+eLr +lk
  TRIDC7AG009460.1 121 RKKLRLSKDQAAVLEECFKTHSTLNPKQKTALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYMKRWCEQLAEQNKRLEKEVAELR-ALK 211
                       69*************************************************************************************9.665 PP

Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    
MHRAAAAGLD LGLGLGLGLA SQGSLTSSTT TASSSPASQA HAQHWTAALN SVVGAQESYG  60
LHPYASHQRK EEPGRTSTSP ESGVSAGTKR GLERTGSGVS RGAATAGSDE DDDGGDGAGG  120
RKKLRLSKDQ AAVLEECFKT HSTLNPKQKT ALANRLGLRP RQVEVWFQNR RARTKLKQTE  180
VDCEYMKRWC EQLAEQNKRL EKEVAELRAL KTAPAAHAQQ AATLTMCPSC RRVAATAAGP  240
AATQHQHQHQ QPQQCSPKPN AHPAGNVLPS HCQFFPSTTT AAAPDRSGRQ QGAWNGAAQP  300
LVTRELF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170178RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-46HD-ZIP family protein