PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG009450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 295aa    MW: 31548.4 Da    PI: 9.894
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG009450.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81e-19122176256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Lee+F+ +++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC7AG009450.1 122 RKKLRLSKDQAAVLEECFKTHSTLNPKQKTALANRLGLRPRQVEVWFQNRRARTK 176
                       678899***********************************************98 PP

2HD-ZIP_I/II125.22.9e-40122211191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rlsk+q+++LEe+F+++++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e++kr++d+l+e+n+rLekev+eLr +l
  TRIDC7AG009450.1 122 RKKLRLSKDQAAVLEECFKTHSTLNPKQKTALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYMKRWCDQLAEQNRRLEKEVAELR-AL 211
                       69*************************************************************************************9.55 PP

Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    
CRRSMMHRVA DLDLDLGLGL GIASQGSLTS STTTDSSSPA SASHSQHWTA ALSSVVGAHE  60
SYGLHQYANQ QRKDEPGMRP STSPESGVSG GTKRGLERTG SGVSRGGATA GGDEDDDGTG  120
GRKKLRLSKD QAAVLEECFK THSTLNPKQK TALANRLGLR PRQVEVWFQN RRARTKLKQT  180
EVDCEYMKRW CDQLAEQNRR LEKEVAELRA LKVAPPANNG APAGALTTLT MCLSCKRVAS  240
TSSASACNVP SFSSNAGIGM PMPSPEQRQF FCAFRDTGAM YGGSSGLAKV VKPTR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171179RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.13e-52HD-ZIP family protein