PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG009440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 66aa    MW: 7416.43 Da    PI: 11.6123
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG009440.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.2e-18962356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      k  +++k+q  +Lee+F+ ++ ++ ++ + LA++lgL  +qV vWF+NrRa+ k
  TRIDC7AG009440.1  9 KNLRMSKDQSAVLEECFKTHSALNPKQNTALANRLGLRPQQVEVWFHNRRARTK 62
                      556799**********************************************98 PP

2HD-ZIP_I/II828.8e-27866159
       HD-ZIP_I/II  1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkql 59
                      +k +r+sk+q+++LEe+F++++ L+p++ ++la++Lgl+p+qv+vWF nrRARtk+kq+
  TRIDC7AG009440.1  8 RKNLRMSKDQSAVLEECFKTHSALNPKQNTALANRLGLRPQQVEVWFHNRRARTKLKQT 66
                      5899*****************************************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    
GGDGAGGRKN LRMSKDQSAV LEECFKTHSA LNPKQNTALA NRLGLRPQQV EVWFHNRRAR  60
TKLKQT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15765RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-28HD-ZIP family protein