PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG009430.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 170aa    MW: 18730.7 Da    PI: 10.4758
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG009430.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox36.39.8e-1219472856
                      HHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox 28 eereeLAkklgLterqVkvWFqNrRakek 56
                      +++  LA++lgL  rqV vWFqNrRa+ k
  TRIDC7AG009430.4 19 KQKLALANSLGLRPRQVEVWFQNRRARTK 47
                      57778**********************98 PP

2HD-ZIP_I/II89.15.3e-2918832692
       HD-ZIP_I/II 26 perKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92
                      +++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e++kr++++l+e+n+rLekev+eLr +lk
  TRIDC7AG009430.4 18 QKQKLALANSLGLRPRQVEVWFQNRRARTKLKQTEVDCEYMKRWCEQLAEQNRRLEKEVAELR-ALK 83
                      589***********************************************************9.565 PP

Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    
MERSMMGKEM TWISLHLQKQ KLALANSLGL RPRQVEVWFQ NRRARTKLKQ TEVDCEYMKR  60
WCEQLAEQNR RLEKEVAELR ALKAAPPAHN GASAGPLTTL TMCLSCKRVA STSSASACTV  120
PSFSSNAGIG MPVPSPVAMP EHRQFFCGFR DTGATYGSSA GLAKVVKAAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14250RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.17e-39HD-ZIP family protein