PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC7AG007210.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 331aa    MW: 36523.2 Da    PI: 9.9438
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC7AG007210.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind381.81.1e-11613311301
         GAGA_bind   1 mdddgsre..rnkg.yye........paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkll 82 
                       md+ g+re  r+++  y+        p++++k++ +++l+++++erd++i er++al+ekkaa+aerdmaf+qrd+a+aern+a+verdn+l+
  TRIDC7AG007210.2   1 MDNLGHREngRQRPdPYKalhtqwmmPQRQMKDHHSMNLLALMSERDTAIMERDHALAEKKAAMAERDMAFAQRDSAMAERNAAIVERDNALA 93 
                       99999998899999888899999999889**************************************************************** PP

         GAGA_bind  83 alllvensla...salpvgvqvlsgtksidslqqlse.....pqledsave.lreeeklealpieeaaee.akekkkkkkrqrakkpkekkak 165
                       al+l++++     s ++++ ++l+g+k+ ++++q+ +      ql+ds+++ +re+++++a+pi++a+ + a ++kk+kk++++++p+++ + 
  TRIDC7AG007210.2  94 ALELARTNGFnmnSGNGFNPGSLNGAKNFHHHDQQPHaqsspLQLADSPYDhAREMHISDAYPISTAPVTaAGKAKKPKKNSSQASPLKRPSG 186
                       **9998875545588889999***********99877789999********9*************9976516789999***********9999 PP

         GAGA_bind 166 ..kkkkksekskkkvkkesader.......skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstk 249
                         +k+kk   ++++  ++++ e+       +k+e+k++dl+ln+vs+Des++P+P+CsCtG+lrqCYkWGnGGWqS+CCt+++S+yPLPv+++
  TRIDC7AG007210.2 187 vlRKTKKAGGDWRDAGMSGVGEDparaaseMKNERKDQDLGLNQVSFDESSMPAPACSCTGVLRQCYKWGNGGWQSSCCTMSMSMYPLPVMPN 279
                       887777788899999998877556788888*************************************************************** PP

         GAGA_bind 250 rrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       +r+aR++grKmS++af+klL++LaaeG+dls  vDLkdhWAkHGtn+++tir
  TRIDC7AG007210.2 280 KRHARMGGRKMSGSAFTKLLSRLAAEGHDLSASVDLKDHWAKHGTNRYITIR 331
                       ***************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    
MDNLGHRENG RQRPDPYKAL HTQWMMPQRQ MKDHHSMNLL ALMSERDTAI MERDHALAEK  60
KAAMAERDMA FAQRDSAMAE RNAAIVERDN ALAALELART NGFNMNSGNG FNPGSLNGAK  120
NFHHHDQQPH AQSSPLQLAD SPYDHAREMH ISDAYPISTA PVTAAGKAKK PKKNSSQASP  180
LKRPSGVLRK TKKAGGDWRD AGMSGVGEDP ARAASEMKNE RKDQDLGLNQ VSFDESSMPA  240
PACSCTGVLR QCYKWGNGGW QSSCCTMSMS MYPLPVMPNK RHARMGGRKM SGSAFTKLLS  300
RLAAEGHDLS ASVDLKDHWA KHGTNRYITI R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.16e-97BBR-BPC family protein